KEGG   Kryptolebias marmoratus (mangrove rivulus): 108239887Help
Entry
108239887         CDS       T05608                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kmr01002]
    108239887 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kmr03110]
    108239887 (pcsk1)
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108239887 (pcsk1)
Peptidases [BR:kmr01002]
 Serine Peptidases
  Family S8: subtilisin family
   108239887 (pcsk1)
Chaperones and folding catalysts [BR:kmr03110]
 Intramolecular chaperones
  Subtilisin family
   108239887 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 108239887
NCBI-ProteinID: XP_017278407
LinkDB All DBs
Position
Unknown
AA seq 772 aa AA seqDB search
MEVRCRPAVMLCVLAVLCAVAPRSLGSLYGDRQYLNEWAVEIPGGMSAAQAIAKELDYDL
VRQIGALENHFLFKHRNHPRRMKRSSDHVTRQLSEDDRVLWAEQQYEKRRNKRAALRDCR
DCSVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWN
HTDIFSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPDLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPAVWKHVPEKKQCIVRDDN
FQPRELKAAGEITIEIPSKACEGQENAVRSLEHVQVEASIEYTRRGDLHITLTSPAGTTT
VLLAERERDTSSNGFRNWDFMSVHTWGEDPAGTWTLKITDTSGRMENKGRILNWKLILHG
TSEKPEHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQARPPQKAEPAPASLSDPEMEP
QTPSDSLYSPSLALLRLLQTAFNRQGTVSQQQHAAPRPSSAWRKQQLSQGIFPTRFPAQK
LYQALDLINKYRGPEDSLYSDYSDGFYNIKPYRHRDDRLLQALFEMLDDARK
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgccgtccagcggtgatgttgtgtgtgttggccgtcctctgcgccgtc
gctccccgctccctgggctctctctacggggacagacagtacctgaacgagtgggctgtg
gagatcccgggcgggatgtccgccgcccaggccatcgccaaggagctggactacgatctg
gtccgacagattggggccctggagaaccacttcttgttcaaacaccgcaaccatcctcgc
agaatgaaacgcagcagcgaccacgtcaccaggcagctgtcggaggatgatcgggtgctg
tgggcagaacagcagtatgaaaagcggcgcaacaagcgagcggccctcagggactgcagg
gactgttccgtggacaagctgtttgacgatcccatgtggaaccagcagtggtacctgcaa
gacacccggacgtcatcctcgctgcccaagctggacctgcacgtgatccccgtgtggcag
aaaggcatcacggggaaaggagtggtcatcaccgtcctcgatgacgggctcgagtggaac
cacacggacatcttctccaactacgacgccgcagccagctacgatttcaacgacaacgac
cccgacccctttcccagatacgactccaccaatgaaaacaagcacggcaccaggtgtgca
ggggagattgcaatgcaggcagacaacaataaatgtggggttggagtggcgtacaactca
aaggtcggaggaattcgaatgctggatggaatcgtgacggacgccatcgaggcgagctcc
attggattcaatccgaaccacgtggacatctacagcgccagctggggacccaacgacgat
ggcaagacggtggagggtcctggtcgactggcccagaaggcttttgagtacggcatccag
aagggccgtggtgggaaaggctctatcttcgtttgggcatcaggtaatggaggccgtcag
ggcgataactgtgactgtgacggctacacggacagtatctacaccatctccatcagcagc
gcctcccagcagggcctgtccccgtggtacgctgagaagtgctcctccactctggctacg
gcctacagcagcggagactacactgaccagaggatcacgagtgcagatcttcacaacgag
tgcactcagactcacaccggaacatcagcttctgctccactggctgctggaatatttgcc
ctggcactggaacaaaatcctgatcttacctggagggacctgcagcacattgtggtctgg
acctcagagtttgatcctttggccaataacccaggctggaagaggaacggagccgggctg
atggtcaacagccgctttggctttggtcttctcaacgctaaagcccttgtggacctcgct
gacccggctgtatggaaacatgtgccagaaaagaagcagtgcatcgtcagggatgacaat
ttccagccaagggagctaaaagcagcaggagagatcactatagagattccaagcaaagcc
tgtgagggacaggagaacgctgtccgctcactggagcacgtgcaggtggaggccagcatc
gaatacacccggagaggggacctgcacatcacactcacctccccagctggcaccactaca
gtactcttggcagagagagagagggacacttcatctaacggcttcaggaactgggacttc
atgtcggttcacacatggggagaagatcctgctggaacctggactttaaagatcacagac
acttcgggccgtatggagaacaaggggcggatcctgaactggaagctgattctccatgga
acatcagagaaaccggagcacatgaagaaacctcgtgtgtacattccttacaatgctgtg
cagaacgaccgccgaggtgtggagcatatggacgacatgatggaggagcccacacaggcc
cgcccacctcagaaggcagagcctgcaccagcctctctctcagatccagaaatggagccc
caaaccccttcagactccctttactctccctccctggccctgctgcgcctcctgcagacc
gccttcaaccgacagggaaccgtgtcgcagcagcaacacgcggcaccaaggccctcctct
gcctggaggaagcagcagctgagccagggtatctttcctacaaggttccctgcgcaaaag
ctgtaccaagctctggacttgatcaacaagtaccgaggccccgaggacagtctctacagc
gactacagcgatggcttttacaacatcaagccgtacaggcacagagacgaccggctgctg
caggccctgttcgagatgctggatgatgctcggaagtga

DBGET integrated database retrieval system