KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240578
Entry
108240578         CDS       T05608                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108240578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108240578
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:kmr03310]
    108240578
Transcription factors [BR:kmr03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    108240578
Nuclear receptors [BR:kmr03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   108240578
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108240578
NCBI-ProteinID: XP_017279647
UniProt: A0A3Q3ABA0
LinkDB
Position
Unknown
AA seq 745 aa
MDQGGVKKIAYRGNDHLSKLVYTESEEGGLLKVAPHSAVSLTSATSVVLPTSPLMQPGQV
TNGLSNSPLPDELTSASAPATIGSLVESPEPRGLTKDQRPQQPHQFQTQTSNAFGHQSLP
QLEASIVDITQSSMDSLIGGSDPNLFAMKTEDFSLDKGEQDSTDLVNAFDSIGKDVDMNQ
KLFNDTSLDLLQEFDLTGSPSDFYVGDDAFLTTLADDSLLVDGDMRGTLEKDIKPTLVES
INTTGALTVTPDSSGVTSPHESSSGLSTASSSTPPTTLPAVVKKEKDTGFIQLCTPGVIK
QEKTSGGYCQMGATSPISICGVSTSGGQSFHFGINSRNNEALQQKDQKPVSGLYLPVTTI
GGAWSRSPSVGDNSPIHRVGELFTSSPTFSSFTRQEGGTAASMTQGKSGTHKICLVCSDE
ASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMN
LEARKTKKLNRLKGCQNSAPPELTPELPVETRSIVPKCMPQLVPTMLSLLKAIEPDTIYA
GYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSF
SLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMAEQFEQMMKISSEFVRLQVSHDEYLCM
KVLLLLSTVPKDGLKSQAVFEEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMH
EVQRRSALVERFRRPWQHRNSASDH
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggatcaaggtggagtgaagaagattgcgtacagaggaaatgaccatctgagcaaactg
gtctacactgaaagcgaggagggaggtcttttgaaagtggcccctcacagcgccgtgtcc
ctcacctctgccacgtctgtcgttcttccaaccagcccactaatgcagccaggacaggtg
accaacggcctcagcaacagcccccttccagatgagcttacctcagcctccgcccctgcc
accattggttccttggtagagagcccagaacccaggggcctgaccaaagatcagaggcct
cagcaaccacatcagtttcagacgcaaacttccaatgcttttgggcatcagagcttgccc
cagttggaggccagtatcgtagacattacccagtcctccatggattcacttatcggggga
tcagaccccaacttatttgccatgaaaacagaggatttctccctggataaaggagagcag
gactccaccgatcttgttaatgccttcgattctatcggcaaagacgtggacatgaaccag
aaactgttcaacgacacgtctctggaccttcttcaagagtttgacctcactggatccccc
tcagatttctacgtaggggacgatgcctttctgaccactctggctgatgattctttgctc
gtggacggggacatgagagggacattagagaaggacataaaacccactttggtagagagc
attaacaccaccggggcgctcacggttacccccgacagcagcggtgtgacaagtccacac
gagtccagctcgggcttgtccacggcctcctcttcgacccctccaaccactttgcctgcc
gtggtgaaaaaggaaaaagacacaggcttcattcagctctgcaccccaggcgtaattaag
caggagaagacgtccggagggtattgtcaaatgggcgccacaagccccatctccatctgc
ggggtgagcacttcaggaggacagagcttccacttcggaatcaactccagaaacaacgaa
gctctgcagcagaaggatcagaagccggtgtcgggcttgtacctcccagtcacgaccatc
ggtggagcctggagcaggagcccgagcgttggcgacaactcgccaatccacagggtcggc
gagcttttcacaagctctccaaccttctccagctttaccagacaggaagggggcactgct
gcatccatgacacaggggaagagcggcactcataaaatctgtctggtgtgctctgatgag
gcgtcgggatgccactacggtgttctcacctgtggcagctgcaaggttttcttcaagaga
gcagtggaaggtcagcataattacctgtgtgctgggaggaacgactgcattatcgataaa
atcagacggaagaactgccccgcctgccgcttccgcaagtgtctgatggcaggaatgaac
ctggaagctcgtaaaaccaagaagctgaatcgcctaaagggctgccagaacagcgccccg
cccgagctgacgcccgagctgccggtcgagacccgctccatcgtgcccaagtgcatgccg
cagctcgtccccaccatgctgtccctcctgaaggccatcgagccggacaccatctacgct
ggctacgacagcacgctacccgacacctccacccgcctcatgaccaccctcaacaggctg
ggggggcggcaggtcatctccgccgtgaagtgggccaaggctctgccaggtttcaggaac
ctgcacctggacgaccagatgactctgctgcagtgctcctggctcttcctcatgtcgttc
agcctcggctggaggtcttaccaacagtgcaacggcaacatgctctgcttcgcgccggac
ctcgtcatcaatgaagagcggatgaagctgccctacatggccgagcagtttgagcagatg
atgaagatttccagcgagttcgtgcggctgcaggtgtcccacgatgagtacctgtgcatg
aaggtcctgctgctgctcagcacagtgcctaaggacggcctgaagagccaggcggtgttc
gaagagatccgcatgtcgtacattaaggagctgggcaaagccatcgtgaagcgcgaggag
aactccagccagaactggcagcgtttctaccagctcaccaagttgttggactccatgcat
gaggtacagagacgcagcgcactggtcgagcgttttaggagaccctggcagcacaggaac
tctgctagtgatcattag

DBGET integrated database retrieval system