KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240579
Entry
108240579         CDS       T05608                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108240579
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108240579
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108240579
   00536 Glycosaminoglycan binding proteins [BR:kmr00536]
    108240579
Cytokines and growth factors [BR:kmr04052]
 Growth factors
  Growth factors (RTK binding)
   108240579
Glycosaminoglycan binding proteins [BR:kmr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108240579
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108240579
NCBI-ProteinID: XP_017279648
UniProt: A0A3Q2ZYE0
LinkDB
Position
Unknown
AA seq 158 aa
MADGETSAAADRCEDGGGGALQDYRRLTRLYCMNGGYHLQILPDGTVQGRRDERDAHAVL
KLKAVDRGVVVIQGTEAERYLAMSDEGRLYSSPAVTDECYFLETLEENHYNTYRSQKYQD
DAWYVALKKNGKAKLGPRTHIGQKAVFFLPRQLDDYKD
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcggacggagagacgtcggcagccgcggatcggtgtgaggacggcggcggcggtgcg
ctgcaggactaccggcggctgacgcggctctactgcatgaacggcgggtaccacctccag
atcctccccgacgggacggtgcagggccggagggacgagcgcgacgctcacgctgtttta
aagctcaaagctgtggacagaggcgtcgtcgtcatccagggaacagaagccgagcggtac
ctggccatgagcgatgaaggccgtttgtacagctcgcccgctgtgactgacgagtgttac
ttcctggaaaccctggaggagaaccactacaacacataccggtcgcagaagtaccaagac
gatgcgtggtacgtggccctgaagaagaacggcaaagccaagctcggcccgagaacccac
atcggacagaaggccgtcttctttctgcccaggcagctggacgactacaaggactga

DBGET integrated database retrieval system