KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240781Help
Entry
108240781         CDS       T05608                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00250  Alanine, aspartate and glutamate metabolism
kmr00410  beta-Alanine metabolism
kmr00430  Taurine and hypotaurine metabolism
kmr00650  Butanoate metabolism
kmr01100  Metabolic pathways
Module
kmr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108240781 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108240781 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108240781 (gad1)
   00430 Taurine and hypotaurine metabolism
    108240781 (gad1)
Enzymes [BR:kmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108240781 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 108240781
NCBI-ProteinID: XP_017280013
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MAASAPPSTNTTSSSSSAGGEADPNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQK
NNSLEERSRIVSSLKERAAKNLLSCDNSGGDARFRRTETDFSNLYARDLLPSKNGEEPTM
QFLLEVVEILTSYMKKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRD
TLKYGVRTGHPRFFNQLSSGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMR
EIVGWPNGEGDGIFSPGGAISNMYSVMVARYKFFPEVKTKGMAAAPRLVLFTSELSHYSI
KKASAALGIGTENLILLKTDERGRVIPAYLEAKIIEAKQKGYVPMFVNATAGTTVYGAYD
PINDIAGICEKYNIWLHVDAAWGGGLLMSKKHRYKLHGIERANSVTWNPHKMMGVPLQCS
AVLVRERGLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTE
GFEQQIDKCLDLSVYLYDKIKNREGFEMVFNGEPQHTNVCFWYIPPSLRRLPDGEEKRER
LHKVAPKIKAMMMESGTTMVGYQPQGDKVNFFRMVISNPAACRSDIDFLVEEIERLGQDL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgccccccccagcaccaacaccacctcctcctcctcctcagctggcggt
gaagcggatcccaactcgacaaatttacggccgccgggctcaagttatgatgcctggtgt
ggagtggctcatggctgcacgaggaaactgggaatgaagatatgtgggttcctgcagaag
aacaacagtctggaggagaggagcaggatcgtgagctccctgaaggagcgcgcggccaag
aacctgctgtcctgcgacaacagcggaggagacgcgcgcttccggcgcacggagaccgac
ttctccaacctgtacgcgcgagatcttttaccttccaaaaatggagaggagcccaccatg
cagttcctgctggaggtcgtggaaatcctcaccagctacatgaagaagacctttgacaga
tccaccaaggtcctggacttccaccacccccaccagctgctggagggcatggagggcttc
aacctggagctctccgaccagcccgagtccctggagcagatcctggtggactgcagggac
accctgaagtatggagtgaggacaggccacccgcggttctttaaccagctgtccagtggg
ttggacatcgtgggactggcaggagagtggctcacgtctacagccaacaccaacatgttt
acctatgagatcgcccctgtctttgtgctgatggagcagctgacgctcaaaaagatgaga
gagatagttggctggccaaacggagagggcgacggtatcttttctccaggaggagccatt
tccaacatgtacagtgtgatggtcgccagatacaagttcttccccgaagtcaagaccaaa
ggcatggcagccgctccaagactggtgctcttcacctctgagctcagccactattcaatc
aagaaagcgagtgcagctctggggatcggaacggagaacctgatcctcctgaaaacagac
gagagagggagagtcattcctgcttatttggaggccaaaataattgaggccaagcaaaag
gggtacgttcccatgtttgtgaacgccaccgcaggcaccaccgtctacggagcctacgac
cccatcaacgacattgcaggcatctgtgagaagtacaacatttggcttcacgtggacgct
gcatggggaggaggtctgctgatgtccaagaagcacagatacaaactacacggaatcgaa
agggctaactcagtcacctggaacccccacaagatgatgggcgtgccgctgcagtgctcg
gccgttctggtcagagagagggggctgttacaaggctgcaactccatgtgcgcgggttac
ctcttccagccggacaaacagtacgacgtgacctacgacaccggggacaaagccattcag
tgtgggcggcatgtcgacatcttcaagttttggctcatgtggaaggcaaagggaacagaa
ggatttgagcagcaaattgacaagtgcctggacctgtcagtgtacctctacgataaaatc
aaaaacagagagggctttgagatggtgttcaacggagagccgcagcacactaatgtctgc
ttttggtacattccaccgagcctgcgccgcctgcccgacggcgaggagaagcgcgagagg
ctgcacaaggtggccccgaagatcaaggcgatgatgatggagtcgggcaccaccatggtg
ggttaccagccacaaggagacaaagtcaatttcttccgcatggtcatctccaaccctgcc
gcctgcaggtcggacatcgactttctggtcgaggagatcgagcggctgggccaagacttg
taa

DBGET integrated database retrieval system