KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240964
Entry
108240964         CDS       T05608                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04012  ErbB signaling pathway
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108240964
   04068 FoxO signaling pathway
    108240964
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108240964
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108240964
NCBI-ProteinID: XP_017280283
UniProt: A0A3Q2ZAI4
LinkDB
Position
Unknown
AA seq 240 aa
MTFAEHACSVSASEEGSARGLKTGGLEVLGRACVRVRACVCLPPPPSSSSSSRTCSKMSD
VRLSNASPTVERVDARQPDSVRPVRRVLFGAPDREETRRYAAELQRDSARDFVERYNFDP
ETDTPLPPGGYEWEEDGQAPEFYSRPPHRRRRPPRGEAGGSPGDRPSGEEGRRSSESAQG
TNGSRKQRPRAADPCSDEHQDKRSKSDRDDEDEDDGCAGSLVKAADKPEDSQEVPLNAEH
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacattcgcggagcatgcatgctccgtttctgcgtctgaagaagggagtgctcgcggt
ctgaaaacagggggtctggaagttctcggtcgtgcgtgcgtgcgtgtgcgtgcgtgtgtg
tgtcttcccccccctccgtcctcctcttcctcgtcgcgtacgtgcagcaagatgtcagat
gttcgcctctccaacgcgagcccgacagtggagcgggtggacgcgcggcaacccgacagc
gtccgcccggtgcgccgggtgctgttcggcgcgccggaccgggaggagacgcggaggtac
gcggcggagctacagcgggacagcgcgcgggacttcgtggagcggtacaacttcgacccg
gagaccgacacgccgctcccccctgggggctacgagtgggaggaggacgggcaggcgccg
gagttctacagcaggccgccccacaggaggcgacggccgccgcggggagaggctggaggc
tcccccggcgaccgaccgagcggcgaggagggcaggaggagctcggagtccgctcaaggg
acgaacggttcgaggaaacaacgaccccgagctgcggatccctgctctgatgaacatcag
gacaagaggtcgaagtcggacagagacgacgaggatgaggacgacggctgtgcaggaagt
ctggtgaaggcagccgacaagccggaggacagccaggaggtcccgttaaacgcagagcac
tga

DBGET integrated database retrieval system