KEGG   Kryptolebias marmoratus (mangrove rivulus): 108241005
Entry
108241005         CDS       T05608                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04012  ErbB signaling pathway
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
kmr04115  p53 signaling pathway
kmr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108241005
   04068 FoxO signaling pathway
    108241005
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108241005
   04115 p53 signaling pathway
    108241005
   04218 Cellular senescence
    108241005
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108241005
NCBI-ProteinID: XP_017280373
LinkDB
Position
Unknown
AA seq 238 aa
MQALHENVCHILSWEEEVAAGAKIFDLLLLRGEERRTGAQQDRTEIWRSGFFYLHQYITS
DKAMAATSASTGGSEASGAELSPPGGAEASKVKAAPVRRNLFGPVDHQQLQQDFQRLLCM
SVEVANKRWNFDFQRDRPGEGASIQWAELRCQDVPAFYRSCSVRPGARRRASTSSVSSSG
EGSPVSSSSSGSGDEYLEVTTRGRYSIQRPQKRRQSAITDFFKVKKSRLLHSKASSRQ
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcaagcactacacgagaatgtgtgtcacattttgagctgggaggaggaagtggcggcc
ggtgccaaaatatttgacctacttcttctgagaggagaggagaggagaacaggagcgcaa
caagaccggaccgaaatctggaggagcgggtttttttatttacaccaatatataacaagt
gacaaggccatggccgctacatcggcatcaacaggtggatccgaggcgtccggcgccgag
ctctcgcctcccggaggcgccgaggcctcgaaggtgaaggcggctccagtgcggcggaac
ctcttcgggcccgtcgaccaccagcagctgcagcaggacttccagaggctgctctgcatg
agcgtggaggtcgccaacaagcgctggaacttcgacttccagcgggacaggcccggagag
ggcgccagcatccagtgggcggagctcaggtgccaggacgtgccggcgttctaccggagc
tgctcggtgcggcccggagccaggaggcgggcgtcgacgtcgtcggtgtcgtcgtcgggc
gaaggctcccccgtttccagcagctcgtccgggtccggggacgagtacttggaagtgacc
acgagggggcgctactccattcagcgaccgcagaaacgacggcagtctgccataacagac
ttcttcaaggtgaagaagagtcggcttcttcattccaaggcgtcctcgcggcagtga

DBGET integrated database retrieval system