KEGG   Kryptolebias marmoratus (mangrove rivulus): 108241152Help
Entry
108241152         CDS       T05608                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X2
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108241152 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kmr03036]
    108241152 (setdb1)
Enzymes [BR:kmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108241152 (setdb1)
Chromosome and associated proteins [BR:kmr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108241152 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108241152 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Tudor_4 DUF5604 TUDOR_5 Pre-SET MBD 53-BP1_Tudor DUF745
Motif
Other DBs
NCBI-GeneID: 108241152
NCBI-ProteinID: XP_017280609
LinkDB All DBs
Position
Unknown
AA seq 1273 aa AA seqDB search
MENSERMEVDGWDPSLEEELGVSLDDLKKLIEEAVEQSDIVQKKKAQLKELKQWVEQKEE
EEAKTERLLNDANQSIVECEMLVRAAYQKNGLVYRESSSDDDGGGGDGLTSEVIEIDDDD
DDDVIAVGCLVPPKKSLTPAKDPGLKEASAVLQKTSQQVQKLALMVSKPSAGPQLIRSPA
QPSAQSAIQSSAPAIFVSQAPSQALTQPNPNIKEDELKVGMTILGKKRTKTWHRGTLVAI
NPIGNSAFKYKVRFDKGKSLLSGNHVAFEYNPTLESLFVGARVVAKYKDGNLVWLYAGIV
AEMPNNKNRMRFLIFFDDGYASYVILPELYPVCRPLKRTWEDIEDASCRDFIEEYISAYP
SRPMVLLKVGQIIKTEWEGTWWKSKVEEVDGSLVKILFLEDKRSEWIYRGSTRLEPMFNL
KMTSANTHEKKLAGHQRTRPNMGALRSKGPVVQYTGVEHVGASPAQAPQASPSQPSTAPQ
PPQPSQPPQPPQPQQPLQPLQPQQPLQTIQVLQAQQTPHTLQILQPLQTLQPIQATHLQY
LQNKHQMAKKSTSPFVPGVGGTHASKVLQSLPSSSTNLSSAKTLSAPSAPPSSSAPLFQR
PQPSVAAPPPPPPPPPPPVTHAMATIPQQPSYRAPTDRIFYLAHTCQPACLNRVRPVKQD
VHRGKNPLLTPLLYDFRRMTSRRKVNRKVSFHVTYKAPCGLCLRNMSEIQNYLFQSRCDF
IFLEMFCLDPYVLVDRPFQPQRPFYYIPDITSGKEDIPLSCVNEIDTTPPPKVAYSKERI
PEDGVFINTSADFLVGCDCTDGCRDKSKCFCHQLTLQATACTPGAQINQNAGYSYKRLEE
CLPTGIYECNKRCKCCAQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIY
AGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDVSKIKIQ
PSALVSATSGGRLPRKARSSSSSSSSNDEEKESKSEDESDSSDDTFVKDNYFNSSSVWRS
YTTRGQVKGNKEGSQDSKDGLSVSGGAAGEKPPSIPEETGKSKVASWLTSQGLKKDTEDK
SQARKQDVMTLSDSDDVQTISSGSDDNKDRDKAAPASGPSVTKKQVAVKSTRGIALKHSH
SMMVKTGTPGGGAGPSGQGGKHGQQGQPGGGGENAPRNTRLFFDGEESCYIIDAKLEGNL
GRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELL
CCCGSTECRGRLL
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtgagaggatggaggtggacggctgggaccccagtctggaggaggagctg
ggcgtttccctggatgacctgaagaagctgatcgaagaggccgtggagcagagcgacatc
gtgcagaagaaaaaagcccagctgaaagagctcaagcagtgggtcgagcagaaagaggag
gaggaggcgaagacagagaggcttctcaacgatgccaaccagtctattgtagagtgcgag
atgctggtgagggcggcgtatcaaaagaacggacttgtctaccgggagagcagctcggac
gatgacggaggcgggggagatggactgacctctgaagtgatcgagatagacgatgacgac
gacgacgacgtcattgcagttggttgtttggttcctccaaagaagagtttaactcctgcc
aaagatccagggttgaaagaagcctctgcagtgctccagaaaacctcccagcaggtgcag
aagctggccctgatggtgagcaagccctcagcgggacctcagttgatccgatctccagca
cagccttcagcccagtcagcgattcagagctcggcaccagcgatatttgtatcgcaggct
ccctctcaggcgctgacccagccaaaccccaacataaaagaagatgagctgaaagttggg
atgaccattctgggaaaaaaacgcaccaagacgtggcaccgaggcacgctcgttgctatc
aaccctattggaaatagtgcgtttaaatataaagtgaggtttgataaagggaagagtttg
ctgtctgggaatcacgtggcttttgaatacaacccgaccctggagagcctgttcgttggg
gcccgcgtcgtcgccaagtacaaagatggaaacctggtgtggctctacgcggggattgta
gcagagatgcccaacaacaagaaccgcatgaggtttttgatcttctttgacgacggctat
gcttcatacgtgatcctgcctgagctctacccagtttgcagaccactaaaacgtacctgg
gaggacatagaggacgcatcctgtcgagacttcatcgaggagtacatttcagcctatccc
agcaggccgatggtgctcctgaaggtcggccagatcatcaagacggagtgggagggaacg
tggtggaagagcaaagtggaggaggtggacggcagcttggtcaaaattctctttttggaa
gacaaaaggagcgaatggatttacagaggatccaccagactggagcccatgttcaatctg
aaaatgacttcagcgaacacccatgagaagaagctggccggccaccaaaggacgagacca
aacatgggggcactgaggagtaaaggcccagtagttcagtacactggtgttgaacacgtt
ggagcgtctcccgcccaagcgccgcaggcatcacccagtcagccttcaacagcgccgcag
cctcctcagccttctcagcctcctcaacccccgcagccccagcagcccctgcagcccctt
cagccccagcagccccttcagaccattcaggtccttcaggcccagcaaacccctcatacc
ctgcaaatccttcagccgctccaaactcttcagcccatacaagctacacatcttcagtat
cttcaaaacaagcatcagatggcaaagaagagcacttctccgtttgtccctggggtggga
gggacacacgcttccaaagtcctgcagtctttgccctcaagttccaccaacctctcaagt
gcgaagacgctgagtgctcccagcgcccctccgtcctcatccgcgcctctgttccagagg
ccgcaaccctccgtggcggctcctcctcctcctcctcctcctcccccccctcccgtgacg
cacgccatggccaccatccctcagcagccctcctacagagccccgacggacaggatcttc
tacctggcacacacctgccagccggcgtgcctgaaccgcgtccgaccggtcaagcaggac
gtgcaccgagggaagaaccccctcctcacccctctgctatatgatttcagacgtatgacg
agtcggcgcaaagtcaaccgcaaggtgtccttccatgtaacctacaaggctccgtgtgga
ctttgcctgcgaaacatgtcggagatacagaattacctcttccagtctcgctgtgacttt
atattcttagagatgttctgtctggacccctacgtgctcgtggaccggcccttccagcca
cagaggcccttctattatattccagacatcaccagcgggaaggaggacatcccactgtcc
tgtgtcaatgagatcgacaccaccccgcctcctaaagtggcctacagtaaggagcgaatt
cctgaagacggagtgtttattaacaccagtgcagatttcctggtcgggtgtgattgcacg
gacggctgtcgggacaagtccaaatgcttctgccaccagctgaccctgcaggctacagct
tgtacgcccggagcacagatcaaccagaacgcaggatattcgtacaagcgattagaggag
tgcctgccaacagggatctacgagtgtaacaaaaggtgcaagtgttgtgctcagatgtgc
acgaaccgtctggtgcagcacggcctgcaggtccgccttcagctctttaagactcagaac
aaaggctggggcatccggtgtctggatgatatagccaagggttcgtttgtctgcatctac
gctggtaaaatcctgacggatgacttcgctgacaaagaagggttagagatgggcgacgag
tacttcgccaacctggaccacatagagagcgtggagaacttcaaggagggctacgagagc
gaggcccactgctcagacagcgagggaagtggcgtggacgtgtccaagatcaaaatccag
ccgtccgctttagtttcagccaccagcgggggacggcttcccagaaaggcccggagctcg
agctcttcatccagcagcaacgacgaggagaaggagtcgaagagcgaagacgaaagcgac
agttcggacgacacattcgtgaaggacaactatttcaactccagctctgtgtggaggagt
tacaccacacgcggtcaggtcaagggcaacaaggaggggagtcaggacagtaaagacggg
ttgagcgtttctggaggagcggctggtgaaaagcctccgtcgatccccgaagagacgggg
aaaagcaaagtggcctcctggctaacaagccagggactcaagaaggacactgaagataaa
agtcaagcaaggaagcaggatgtgatgacgctctctgacagcgacgatgttcagaccatc
agctcaggatctgatgacaacaaggaccgggacaaagccgctccagcctctgggcccagt
gtgaccaagaagcaggtggcggtgaaatccactcgcggcatcgccctgaagcacagccac
agtatgatggtgaagacggggacgcccggcgggggggcggggccgagcggccagggcggg
aaacacgggcagcaggggcagcccggaggaggcggagaaaacgccccgagaaacactcgg
ctcttcttcgacggtgaagaatcctgctacatcatcgacgccaagttggaggggaacctt
gggcgatacctcaaccacagctgcagtcctaaccttttcgtccagaacgtgtttgtggac
acgcacgacctgaggttcccctgggtggcgttctttgccagcaagcgtatccgggccggc
accgagctcacctgggactacaactacgaggtggggagcgtcgagggcaaagagctgctg
tgctgctgtgggtccacagagtgcagaggaagactgctgtga

DBGET integrated database retrieval system