KEGG   Kryptolebias marmoratus (mangrove rivulus): 108241244
Entry
108241244         CDS       T05608                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108241244
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108241244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:kmr04030]
    108241244
G protein-coupled receptors [BR:kmr04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108241244
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 108241244
NCBI-ProteinID: XP_017280752
UniProt: A0A3Q3G4V4
LinkDB
Position
Unknown
AA seq 346 aa
MASGNNVNNTCFTDENIRFFYNYVGKEIEKNWTSPDIMVIGLGLTLCPIVVLANLMVMVA
IFTNRRFHFPIYYLLGNMAAADLFAGLAYANLMLNTGPWTKMLTKSQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSNMTKRRVSLLVVGIWVIGIIMGLVPSILWNCECNLK
DCSKIAPLYSRSFLIFWAVLNLITFFIMLAMYARIFYYVKHKSLYVSQHNSEMRHNQTVV
NLMKTISMVLGAFVICWTPGLITLLMDGILGKKSNANKYEKYCLVMAVCNSLVNPIIYSL
RDEEMRSTFKFILCRLCHRGVDRQQLSSPIEFKSSLKEKNFDCPEI
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcctctggaaacaatgtgaataacacctgcttcaccgatgagaacatccgcttcttt
tacaactatgtgggcaaagaaatcgaaaaaaattggacctcgccggacattatggtcatc
ggactggggttgacgttgtgtcctattgtagtcctggccaacctgatggtgatggtagcc
atcttcacgaaccgccgcttccacttccccatctattacctcctgggtaacatggcagca
gcagacctgtttgcaggtctcgcctatgctaacctgatgttgaacacaggcccttggact
aaaatgcttactaaaagtcagtggtacatccgtggagctttaattgacatcagcctgact
gcctctgtagccaacctgctagctgttgctgtggagcgccaccagaccatcataaccatg
cagctacacagcaacatgaccaagcggcgggtgtcgctgctcgtagttggcatctgggtc
ataggaatcatcatgggtctggttccctcgatcctttggaactgtgaatgtaatctcaag
gactgctctaaaattgcgcccctctacagccgcagctttctcattttctgggcagttctc
aacctgatcactttcttcattatgttggccatgtacgctcgtattttctattatgtgaag
cacaagagtctgtacgtgtctcagcacaactcggagatgcgacacaaccagacggtagtc
aacctgatgaaaaccatctccatggttttaggggcctttgtaatctgctggacacccggc
ctcataactctcctaatggatggcatattgggtaaaaagagcaacgccaacaaatatgag
aagtactgcctggtgatggcagtgtgtaactctctggtcaacccaatcatttattctctg
cgggacgaggagatgcgaagtacgttcaagtttatcctgtgccgtttgtgtcacagaggt
gtggatcgacagcagctgtcttcacccattgagttcaaatcatcactaaaggagaaaaac
tttgactgtcccgaaatttga

DBGET integrated database retrieval system