KEGG   Kryptolebias marmoratus (mangrove rivulus): 108241771Help
Entry
108241771         CDS       T05608                                 

Gene name
alk
Definition
(RefSeq) ALK tyrosine kinase receptor isoform X1
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108241771 (alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:kmr04090]
    108241771 (alk)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108241771 (alk)
Protein kinases [BR:kmr01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   108241771 (alk)
CD molecules [BR:kmr04090]
 Proteins
  108241771 (alk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108241771
NCBI-ProteinID: XP_017281674
LinkDB All DBs
Position
Unknown
AA seq 1744 aa AA seqDB search
MTTRVVFLLVCSAAFFAGRHCASPRSAAGMEPPNPGSTNVSSGGSSGESGSKRDSNQTIM
SRNKRKTLAVDFAVPSLLRYYLAEFIKRPLNGDCQTFSRCYTVQANLKMHCIPLQKTIST
FVEPKSSTDLRNRSSEGQLPFFYKRPLSKVLNLGLTKASRKSNQVVVEIGEDLVKTGCGG
LTVYEEDPVLLLEMDLTTILEWWLGAEGGRLRVRLMPEKKAQVPGIEDRYTAAIRAADPR
LYLHISSRGESLDGKNAAGSPRGYWSFSWVAENDPNFPNSTVSKSDRQCPGNRRTCDQQF
EDVPDFNWRIVATGDGQKEGKIVKNAGSPQGWEEGKNEGQFFWVNSSAFGGPWVLSPWLW
GGQDLCGLGMAVFLHPEQSGQYTFWRIQRDKPPFALFSTETLPRITGWAVVQLTLGTHEG
SPFRVSASYDQRIPQDDTAIIEPIFTTNCTMPSTSGPNITLEGQYLCHQGPGIPLDKLCD
FSTDCPFGDDEGDRCRRFLNGSYCSFEGGDCGWQSIADRSFAWRRVQSPTKSTRQSCPLS
GATFTIEGGQSKGQRGSALLKSPLFPSPLRNSRCTVRFWLCSGGSQRDSLSLWLVENSTG
PDEQLKLWHLASEPKLDRGWRLITLPLYGLADWFWLQFSAEDGPGPGSTISVDNISFSMD
CFLASNGEFPPVATSTTRITPRPTSKTPPPSIRSPPVTVPTTEDSKKWIFHTCGAVGPEG
PTPTQCSNSYRSSNVNVTVGTEGPFKGIQMWRVPETGTYRITAYGAAGGRSVMAMSRSHG
VYMTGDFLLRRGELLHILVGQQGEDACPNSNAVLQRICLEQSSSTVNKSQVKGGGGGGGG
ATYVFKVDGGVYIPLVIAAGGGGLGYSSQSNNQFEQTDYDHSQQGRNGKSHAAGGGGGWN
DSAPVSQGGRPLVLGGQGGQACQKFWQTRGGFGGGGGGCVSGGGGGGYRGGNTSIDDNPK
ADGDDGTSLFGPYGSPYIYPLKAMEGDGEVIISSAQNCSHCENRDCHESKDGIICHCDAN
FVLASDGVSCINASDVSLLPPQPSLSHLALGLSVGTSALIAALLLAVSGVMIMYRRKHTE
LQSIQLELQSPDCKLSKLRASTIMTDYNPNYCFAGKTASVSDLKEVPRRNISLTRGLGHG
AFGEVYEGLAVGIPGEPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGV
SLQAMPRFILLELMAGGDLKTFLRETRPRLDQPSSLTMVDLLNVARDIAKGCQYLEENQF
IHRDIAARNCLLTCKGQGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGI
FTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQS
WQHQPEDRPNFSTILERIDYCLQDPDVVTTPLPVEYGPVPEEEEHVSIRPDDPSALAVIV
KAQVPDGDAPQPPPAYPAADRRGGEHTVVTSTAAEAKAQTSVQPQPCNHQPHTKTSIAMT
TAITITSTVSDTLTAKPAHVTTQPSSEGGHINLAFAQGHPQEKDGKNTSLWNPTYGSWFL
QQQRQGGVGGPGGSTGRVPGEGQEQVGRTVAEVAGAIGLQHQHKQFQHQLQLLHHQQQQQ
GLCRPLLPPPPPPAGQSPLLLDSTALPPAPLYRLRRFPCGNIGYGYQKHGLPLEAAHGTP
KPPPPQQGTSVPTSANHQRGATIPNPMSLGRSGVSEDSRPLLVTMGTVQDPRLPRMEGHN
ATVL
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagggtggtgtttctgctcgtttgttctgcggcatttttcgcggggcgacac
tgcgcctcaccaaggagcgcggcgggaatggagcctccgaaccccggctccactaacgtc
agcagcggcggcagctctggggaaagcgggtccaaacgggactcgaaccaaaccatcatg
tccagaaacaagaggaaaaccttggcggtggatttcgcggtgccctcactgctgagatat
tatctagcagagttcataaagagacccctgaacggagactgccagacttttagcagatgt
tacacggtgcaggcaaacttgaaaatgcattgcatacctttgcagaaaaccatttctact
tttgtggagccgaaatcctcaacagatctgaggaaccggtcctctgagggacagctcccg
ttcttctacaagcggccgctgtccaaagttctgaatctgggcttaacgaaggcgagcagg
aaatcaaaccaagttgtggtggaaataggggaggatttagtcaagacgggatgcgggggg
ctgactgtgtacgaggaggaccccgtgctcttgttggaaatggacctcacgaccattctg
gagtggtggctcggagctgaagggggccgactcagggtccggctcatgcccgagaagaag
gcacaggtgcccgggattgaggaccgttacaccgcagctatacgcgctgcagacccccgc
ctgtacctccacatatcctctcggggtgaatctttggacggcaagaatgcggctgggagt
cctcggggttactggagcttctcctgggtagctgagaatgacccaaattttccaaacagc
actgtatccaagtcagatcgccagtgccctggtaacagaagaacatgtgaccagcagttt
gaggatgtcccagatttcaactggagaatagtggcaactggggacgggcaaaaagaaggg
aaaattgtgaagaatgctggaagtccacagggttgggaggaaggtaagaatgaaggtcag
ttcttctgggttaacagctcagcgtttggaggaccatgggtcttgagtccgtggttatgg
gggggtcaagatctgtgtggcttgggcatggctgtgtttctccaccctgaacaaagcgga
caatacaccttttggcgcatacagcgagacaagccacccttcgccctcttctctactgaa
actctgccacgaatcacaggctgggccgtggtccaactcaccctggggacccacgaagga
tccccgtttcgggtctcagccagctacgatcagaggatcccacaggatgataccgccatc
atcgagcccattttcaccaccaactgcaccatgccgtctacatctggcccaaacatcaca
ttagagggccagtacctctgccaccagggccccgggatccccctggataaactgtgtgac
ttcagtacagactgtccgttcggggacgacgagggcgaccgttgccgccgctttctcaat
ggcagctactgctcttttgaaggaggtgactgcggctggcagtcaattgcagaccggagt
ttcgcttggagaagagttcagtcaccaaccaaatcaaccagacagagctgcccgttgtca
ggtgcaacatttaccatagaggggggccagtctaaaggtcagcgtggctcagcgttgttg
aagagtcctctcttcccttctccgttaaggaactcccgttgcacggtgcggttctggctg
tgttctggaggttcacagagggactcgctgtctttgtggttagtggaaaacagcaccggg
cctgacgagcagctcaaactgtggcatttagccagcgagcccaaattggacagaggctgg
aggctcatcacacttcctctttacgggctggctgactggttctggctccagttcagtgca
gaagatggacctggacctggttcaaccatctctgttgacaacatctctttcagcatggac
tgcttcttggcatctaatggagagtttccacctgtggccaccagcacaaccaggatcaca
ccgagaccgacatccaagaccccaccaccctccatcagaagccctccagtgaccgtcccc
accacagaggactccaaaaaatggatttttcacacctgtggggctgtgggtcccgagggc
ccaactcccactcaatgctccaactcctacaggagcagcaacgtcaacgtgacagtcggc
accgaggggcccttcaaaggcattcagatgtggcgggtcccagaaaccggcacctacagg
atcactgcctacggcgcggcgggcgggcgcagtgtgatggccatgagcaggtcgcatggc
gtctacatgacaggagacttcctgctcaggaggggcgagctgcttcacatcctggtggga
caacaaggagaagacgcctgccccaattccaacgccgtgctgcaaagaatctgcctggag
cagagcagctcgacggtgaacaaaagtcaagtgaagggaggcggaggaggaggtggagga
gcgacgtatgtgttcaaggtggacgggggagtctacatccctctcgtcatcgctgccggc
ggcggtggtctgggttacagcagccaatcaaacaaccagtttgagcagacggactatgac
cacagccaacagggtcgcaacgggaagtcccacgccgcaggtggaggtggaggttggaat
gacagcgctcctgtcagccagggcggcaggccgctggtgctggggggccagggagggcag
gcctgtcagaagttctggcagacccgcggtggcttcgggggcggcgggggcggatgcgtg
tcgggcggcggcggcggaggctacagaggtggtaacacctccatagatgacaacccaaaa
gctgatggcgatgatgggacgtccttattcggcccgtatggatcgccctacatttaccct
ctgaaagccatggagggagacggcgaggtgatcatcagctcggctcagaactgcagccac
tgtgagaaccgcgactgccatgagagcaaagacggcatcatctgccactgtgatgcaaac
ttcgtcctggcctcagatggcgtgtcctgcatcaacgcctcagacgtgtccctgctgcct
ccgcagccgtccctgtcccacctggctctgggtctgtctgtggggacgtcggccctcatc
gccgccctgctgctggctgtgtctggagtcatgatcatgtatcgacgtaaacacacagag
ctgcagtccattcagctggagctgcagagtccagactgcaagctcagtaagctgcgagcc
tccaccatcatgaccgactacaaccccaactactgcttcgccggcaagacggcgtcggtc
agcgacctgaaggaagtgccgcgacgcaacatttccctcaccaggggtctcggtcacggt
gctttcggtgaagtttatgaaggtctggcagtggggataccaggtgaaccgagtccgctg
caagtggctgtaaagactcttcctgaagtttgctctgagcaagatgagctggacttcctc
atggaggctctaattatcagtaagttcaaccaccagaacatcgtgcgttgcatcggagtc
agcctgcaggccatgcccaggttcatcctgttggagctcatggccgggggagacctcaag
actttcctgagggagactcgaccccggctggaccagccgtccagcctgaccatggtggac
ctcctcaacgtggccagagacatcgctaagggctgccagtatttagaggagaaccagttc
atacacagggacatcgcagctcgaaactgcctactgacctgcaaaggacagggccgcgtg
gccaagatcggagactttgggatggctcgagacatttacagggcgagctattacaggaag
ggggggcgcgccatgttgccggtgaagtggatgccacctgaagccttcatggaggggatc
ttcacatcgaaaacagacacctggtcgttcggggtgctgctgtgggagattttctcactg
ggctacatgccgtatccaagccgcagtaaccaggaggtgttggagtttgtaaccaacggt
ggaaggatggacccgcctaaaaactgtcctggtccagtgtaccgtataatgactcagagt
tggcagcaccagcctgaagacaggcccaacttttctacgattctggagagaattgattac
tgcttacaggaccctgatgtggtgaccacgcccctgcctgtggagtatgggcctgttcct
gaggaggaggaacatgtatccattcgccccgacgacccctcagctctagcggtgattgtg
aaagcccaggtgcctgacggggacgctccccagccacctccagcctatcccgcagcggac
agaagagggggggagcacacggttgtgacaagcacagcagcagaggccaaagcacagaca
tcagttcagcctcagccatgcaatcaccagcctcacacaaagacctccatcgccatgaca
actgctatcaccatcacctccaccgtctctgacacacttactgccaagccagctcatgtc
accacccaaccaagctcagaggggggccacattaaccttgcttttgcccagggtcacccc
caggagaaggacgggaaaaacaccagtctctggaaccccacatacggctcgtggtttctg
cagcagcagaggcagggaggtgtggggggaccagggggtagcactggcagggtacccgga
gaggggcaggagcaggtgggccggactgtggccgaggtggcgggggcgataggtctccaa
caccagcacaagcagtttcagcatcaactgcagctgctgcaccatcagcagcagcagcag
ggtctctgcaggccgctgttacctccaccgcccccgcctgcaggccaatcgcctctgctt
ttagattcaacagccttgcccccagctccactctacagactgagacgtttcccctgtggg
aacatcggatatggataccagaagcatggcctgccgctggaagctgcccatggaaccccc
aagccccctccaccccagcaaggtacctctgtaccaacctcagcaaaccatcagaggggg
gcgactattcccaatccgatgtccttgggtcggtcaggcgtgtccgaggacagccgcccg
ctgctggttaccatgggaacagtgcaggacccaagacttccccggatggaaggccacaac
gccaccgtgctttag

DBGET integrated database retrieval system