KEGG   Kryptolebias marmoratus (mangrove rivulus): 108241827Help
Entry
108241827         CDS       T05608                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00500  Starch and sucrose metabolism
kmr01100  Metabolic pathways
kmr04910  Insulin signaling pathway
Module
kmr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108241827 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108241827 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmr01003]
    108241827 (gys2)
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108241827 (gys2)
Glycosyltransferases [BR:kmr01003]
 Polysaccharide
  Storage polysaccharide
   108241827 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 108241827
NCBI-ProteinID: XP_017281758
LinkDB All DBs
Position
Unknown
AA seq 705 aa AA seqDB search
MPLSRSLSMTSLSGLLPAWEEDELPVEDLLLFEVAWEVTNKVGGIYTVIQSKAKITVDEW
GENYYMMGPYYEHNFKTQVEGCEPPNAAVRKAMDSLTHNGCQVHFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWESCHIGLPYHDREANDSLILGSLIAWFFKELTDHLGDKPNIIGH
FHEWQAGPGLILSRSRKIPMATVFTTHATLLGRYLCAGNVDFYNNLDKFDIDKEAGERQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNVKKFSAMHEFQNMHS
TNKVRIQEFVRGHFYGHLDFSLDKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHKN
DMTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQTVKEKFGKKLYDALLKGQIPDMNA
ILDRDDFTIMKRAIYATQRHGLPPVTTHNMLDDSTDPILSSVRRIGLFNSRNDRVKVIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSPEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYMYARHLALSRSFPDKFKMDPKAPVKTEGFRYPRPSSVPPSPSASVHSTPHHSD
VEDDDDDEPYDEDDEAERDRLNIKTPFVLGGVPEGKKKQPGESGL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtctcgatccttgtccatgacgtccctgagcgggctgctgccggcctgggag
gaggatgagctgcctgtggaagacctgctactttttgaagttgcctgggaggtcaccaac
aaagttggaggaatttacacggtcatccagtccaaggctaagattacagtggatgaatgg
ggcgagaactattacatgatggggccctactatgaacacaacttcaagactcaggtggaa
ggctgtgagccacccaacgctgccgtccggaaggccatggattctctcactcacaacggc
tgccaggttcatttcggccgctggctgatcgagggcagtccttatgtgatcctgttcgac
attggctcagctgcctggaacctggaccgctggaagggcgacctgtgggagtcctgccac
attggcctgccgtaccatgaccgagaggccaacgactcgcttatcctgggctccttgatc
gcctggttcttcaaagagctaacagaccaccttggagacaagcccaacatcatcggtcac
ttccacgagtggcaggcgggccctgggcttattctgtcacgctctcgcaagattcccatg
gcaacggtcttcacgactcatgccacgctgctgggaaggtacctgtgtgccgggaatgtg
gacttttacaacaacctggacaagttcgacattgataaggaggccggtgagaggcagatc
taccaccggtactgccttgagcgagcagcggtgcactgcgctcacgtcttcaccacagtc
tcccagatcactgccgtggaggccaaccacatgctgcacaggaaaccagatgtggtgaca
ccaaatggactgaatgtgaagaagttctccgccatgcacgaatttcagaacatgcactcc
accaacaaggtccggatccaggaatttgtcagaggacatttctatgggcatcttgacttc
agcttggataaaactctgttcttcttcattgctggacggtacgagttctccaacaaggga
gctgatattttcctggaatcactgtccagactcaactacttactgcgtgttcataaaaat
gatatgacagtggtggttttcttcatcatgccggctaaaacgaacaacttcaatgtggag
tcactgaaggggcaagcagttcgcaaacagctgtgggatacagctcaaactgtgaaagaa
aagtttggtaaaaagctctatgacgcgctgttgaaagggcaaatcccagatatgaacgcc
atcctggatcgagatgacttcaccatcatgaagagagccatctatgctacgcagaggcat
ggtcttcctcctgtgaccactcacaacatgctagatgactccacagatcccatcctgtcc
agcgtcagacgcatcggcctcttcaactcaaggaatgaccgtgtcaaggtcatcttccac
cctgagtttctctcctccaccagccctctgttgcccatggactacgaggactttgtccgc
ggctgtaacctcggcgtgtttccttcctactatgaaccatggggttacacacctggggag
tgtactgttatgggtattcccagtgtgaccaccaacctgtcaggctttggctgttttatg
gaggagcatgtctcagaccctgcagcctatggtatctacattgtagaccggcggttccga
tcccctgaggagtcctgtaaccagctcactcagttcatgttcagtttctgccagcagtct
cggcgccagcgcatcatccagcggaaccgaactgagaggctgtctgacctgctggactgg
agatacctgggacggttttacatgtatgcccgccatctggccctcagcagaagtttccca
gacaagttcaagatggatcccaaagctcctgtgaagacggaaggtttccggtacccccgg
ccctcctcggtgcccccctctccctctgcctccgtccactccacccctcaccacagtgac
gttgaggatgacgacgacgatgaaccgtacgatgaagacgacgaggcagagagggatcgg
ctgaacatcaagactccttttgtcctgggaggtgtgccagagggcaagaagaagcagcct
ggagagtcaggactctga

DBGET integrated database retrieval system