KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243392
Entry
108243392         CDS       T05608                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04020  Calcium signaling pathway
kmr04144  Endocytosis
kmr04510  Focal adhesion
kmr04540  Gap junction
kmr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108243392 (pdgfra)
   04020 Calcium signaling pathway
    108243392 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108243392 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108243392 (pdgfra)
   04540 Gap junction
    108243392 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108243392 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108243392 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:kmr04090]
    108243392 (pdgfra)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108243392 (pdgfra)
Protein kinases [BR:kmr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108243392 (pdgfra)
CD molecules [BR:kmr04090]
 Proteins
  108243392 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE C2-set_2 Receptor_2B4 Kinase-like
Other DBs
NCBI-GeneID: 108243392
NCBI-ProteinID: XP_017284260
UniProt: A0A3Q3F2F7
LinkDB
Position
Unknown
AA seq 1375 aa
MDGKKTFMVFGVILVLMVLVPPGLALPVISPDQHFLLVQANSLINISCSGEQDVVWIEPL
PKDAKVIPGVFSSTILIYNATKAHTGPYDCKYANPDIDKDRPMIFLFVQEPEIEVKFVVL
VKASEEKLRARQPLNISCITPLVPNLHQQWIHSTKQALNAIQTKETFHNRVEYTLSIPQA
TSQDSGVYECSVTHTVSGKTRASSVAVTVFEENSFLTLDHSGILTTEFVNILEATEYTIL
ISAYPVPKVSWLKDGKEMSENYYISTKTSHIEGNRYESILTFRHFLEKDNGNYTIRVQSG
SHTAQFSFVIKVRASAASVIPPSSAPVMLPDMDEMVVPLYTSFSLTCRGVAQLEWDMPFD
VPEQTQEDSSGLFVTTITVDSANVMNTGSYTCFYTTNSTDDTEESSIYVYVPDPDALFVP
SLGSFMNLVLPDHEEMVIPCRVSNPHAHVTLVNVDTQQPVPCVYDSKRGALGVFTAGTYV
CKATQKGKEYYSEEYIVHGVIGTLNVELWAKKTALLVGDTITVSCLARGPDILEDYWKYP
GKMASRGTKTVRENKRDQEVIYTLTIPQATTKDSGIYSCSITDIISNESQMKQLAIQVFA
SEFVSIKPEFRDYESAELDEVRDFRAKIDSFPDAHVTWFKDGIPLGEVTAEIATSLQQIS
EISYISVLILIRAKEEDSGNYTMHVQNGNQSHDVSFTLEVKVPAVIVDLMDLHHGSTTGQ
SVVCITRGQPTPVVEWFICKNIKHCANDSSSWLPLPTNSTEITTESHFNQASNLESQVMF
GHLESTLAVRCLARNEMATVSREVKLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVIWK
QKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEG
TAYGLSHSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPI
YIITEYCFYGDLVNYLHKNRENFHSMSPEKNKKELDIFGINPADESSRSYVILSFENKGD
YMDMKQVDNTQYVPMLEMSTSSKYSDIRRSNYDHPPSQKGLNESEMDTLLSDDSNEGLTT
ADLLSFTYQVARGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSK
GSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSG
YRMSKPEHAPHDVYEMMMKCWNSEPEKRPSFMGLSDSVESLLPSSYKRHYERVNHDFLKS
DHPAVTRVCNETDADYIDIPYKNQGKLKDRESGFDEQRLSSDSGYIIPLPDLDPVSDEDY
GKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4128 nt   +upstreamnt  +downstreamnt
atggatgggaagaagactttcatggtctttggggttattcttgtgctgatggttttggtt
ccgcctggactggcgttaccagtcatcagtccggatcagcactttctgctcgtacaggcc
aactccctcattaacatcagctgctccggggaacaagacgtggtttggattgagcccctg
ccgaaagatgccaaagttattccaggagttttctcctcaactatattaatttacaacgca
actaaggcgcacactggtccttatgactgcaaatatgcaaacccggacattgacaaggat
cgtccaatgattttcctctttgtccaagaacctgagattgaggtgaaatttgtggtgctg
gttaaagcaagtgaagagaagttgagggcgaggcagcctctcaacatctcctgcatcacc
ccattagtgccaaacctccatcaacaatggatccattcaacaaaacaggctctgaatgca
attcagacaaaggagacttttcacaacagggtcgagtacaccctcagcatcccacaagcc
acctctcaggacagcggcgtttacgaatgctccgtcacgcacacagtcagcggaaaaacc
agagccagcagcgtggctgtgactgtttttgaggagaattcctttctgaccctggaccac
agtgggattctaacaacggagtttgtcaacattttagaggcgacagagtacactattctt
atcagcgcttaccctgtccccaaagtgtcatggctgaaagatggcaaagaaatgtctgaa
aactactacatctctactaaaacaagccacattgaagggaatcggtatgagagcattctg
acgttccggcattttctggagaaagacaatggaaattacaccatcagagtccagagtggc
tctcacacagctcagttctcttttgtcatcaaagtgagagcttcggccgcatcagtgatc
ccgccttcctcagcccctgtgatgctgccagatatggacgagatggtggtgcctctttac
acatctttcagcttgacgtgtcgcggagtggcacagctggagtgggatatgccttttgat
gtgccagaacaaacgcaggaggacagcagtggtctgtttgtcaccaccatcactgtggac
agtgcaaacgtaatgaacactggctcctatacatgcttctacaccacaaacagcacagat
gacacagaggaaagcagcatctacgtctacgtaccagatcctgatgctctgttcgtgccg
tcactggggtcttttatgaaccttgtcctgcccgaccacgaggagatggtgattccatgt
agggtgtctaacccacatgcccatgtcacactggtgaacgttgacacccagcagcctgta
ccttgtgtttatgacagtaaaaggggtgctttgggggtatttactgctggaacttatgtc
tgcaaggccacccaaaaaggaaaggagtactacagcgaggaatacatcgtacatggtgtg
ataggtacattgaatgttgagttgtgggccaaaaagactgctctgctggtgggggacaca
atcactgtcagctgtctggctcgaggacctgatatattggaagactactggaaataccct
ggcaaaatggccagtcgcggcaccaaaactgttcgtgaaaataaaagagaccaggaggtc
atttacaccctgacaattccacaagccacaaccaaagacagtggcatctactcctgttcc
atcactgacattatttctaatgaaagtcagatgaagcaacttgccatccaagtgtttgcc
agtgagtttgtatctatcaagccagagtttagggattatgaatctgctgagctggacgaa
gttcgggacttcagagcaaagatcgactcctttcccgatgctcatgtcacttggtttaaa
gatggcataccactcggtgaagtgacggctgagatcgccaccagcctgcagcagatcagt
gagatcagctacataagtgttctcatactgatccgtgccaaggaggaggacagtgggaac
tacactatgcacgtgcagaatggaaaccaaagtcatgatgtcagcttcaccctggaggtt
aaagtgcctgcagtcattgtggacctgatggacctccaccacggttcaaccacaggccag
tctgtggtgtgtatcaccagggggcagcccactcctgtggtggagtggttcatctgcaag
aacatcaaacattgtgccaatgattcgtcgtcttggctgcccctccccaccaactccaca
gagatcaccacggagtcgcacttcaatcaagcgagcaacctggagagccaggtcatgttc
ggccatcttgaaagcactctggcagtgcgttgccttgccaggaatgaaatggccaccgtc
agcagggaagtcaaactggtgtccaatggccctcatcctgagctgactgtagctgctgct
gtgctggtgctcctggtcatagtcatcatctcactcattgtcttggttgtcatctggaaa
cagaaaccaagatatgagatccgttggagggtcattgagtccgtgagcccagatggccat
gagtacatctatgtggatcccatgcagcttccctatgactccagatgggagtttccccgt
gacagacttgtcctcggtcgcatcctgggctctggggcttttgggaaggtggttgagggc
accgcctatggactcagccactctcagcctgttatgaaggtggcagtaaaaatgttgaaa
cccacggctcggtccagcgagaaacaggccctgatgtctgaactgaagatcatgactcat
ctcggaccccatctaaacattgttaacctcctgggagcatgcaccaagtcaggccctatc
tacattatcaccgagtactgcttctacggagacctggtcaactatctgcacaagaacagg
gagaacttccacagcatgagcccagagaaaaacaaaaaggagctggatatatttggtatc
aaccctgcagacgagagcagcagaagttacgtgatcctatcctttgagaataaaggagac
tacatggatatgaagcaggtggacaacactcagtatgtccccatgctggagatgagcacc
tcctccaagtactctgacatccggaggtctaactatgaccaccctccctcacagaaaggc
ttgaacgagtctgagatggacaccctgctgtcagatgactcgaacgaaggcctcacaacc
gctgacctgctgagctttacctaccaggtggccaggggaatggagtttctggcttccaaa
aactgcgtgcatcgggaccttgcagccaggaacgttctcctctcgcagggcaagattgtt
aagatctgtgactttggactggccagagacatcatgcatgacaacaactatgtctccaaa
ggaagcacatttttgccagtaaaatggatggcaccagaaagtatttttgacaacctctac
accactctcagtgatgtttggtcgtatggcatcctcctctgggaaatattctccttaggg
ggcacaccgtatccggggatggtggtggactccagcttctacaacaagatcaagagtgga
tacaggatgtcaaaaccagagcacgcaccacatgacgtgtatgagatgatgatgaaatgt
tggaacagtgagccggagaagaggccttccttcatgggtctgagtgactctgttgagtct
ttgctgccctccagctacaagaggcattacgagagagtgaaccatgactttctgaagagc
gaccatcctgctgtgactcgggtgtgcaacgaaactgacgcagattacatcgacatccca
tacaagaaccagggcaagctaaaagatcgggaaagcggctttgacgagcagcgcctgagc
tctgacagtggctacataatcccactcccggaccttgacccagtatctgatgaagactat
ggaaagaggaacagacacagctctcaaacatctgaggagagcgccattgagacagggtcg
agcagctccacctacgccaagcgtgagggcgagactctggaggacatcacgctgctggac
gagatgtgtctggactgtagtgacctggtggaggacagctttctgtga

DBGET integrated database retrieval system