KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243798
Entry
108243798         CDS       T05608                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04068  FoxO signaling pathway
kmr04217  Necroptosis
kmr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108243798 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108243798 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108243798 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108243798 (stat3)
Transcription factors [BR:kmr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108243798 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AP1AR
Other DBs
NCBI-GeneID: 108243798
NCBI-ProteinID: XP_017284963
UniProt: A0A3Q3BML9
LinkDB
Position
Unknown
AA seq 787 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQNAT
TASQNGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKNAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKETGDVAAIRGARKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLVTFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDIGGKTQIQSVEPYTKQQLSSMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEDAFGKYCRPEAAHEPEAGGDSMSITQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFLMSPRTLDSLDSLMPSDAEANQGPLDSITLN
MDVASPM
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggaaaccaggtatctggagcaactctaccac
ctgtacagtgacagcttccccatggagctacgacagttcctggccccgtggattgagagt
caggactgggcctacgctgccaacaaggaatcacacgccacgctggtgttccacaacctt
ttgggagaaatagaccagcagtacagccgcttcctgcaggagaacaatgtcctctaccag
cataacctgcgcaggatcaaacagcatctgcagagcaaatatctggagaagccgatggaa
atcgctcggattgttgcccgttgtctgtgggaggaacaaaggctgctgcagaacgccacc
actgcttcacagaatggccaggcggcccatcccactggaaccgtagtgacagagaaacag
cagatactggagcacaacctccaagacatcaggaagcgagtgcaggatatggagcagaag
atgaagatgcttgaaaacttgcaagatgattttgactttaattacaagaccctgaaaagc
caaggggagttgtcacaggacctgaatggaaatagccaggcagctgccacgagacagaag
atggctcagctggagcaaatgttgagcgctctggaccagctcaggaggcaaatagtgaca
gagatgggaggcctgctgaccgcaatggattatgtacagaagaatctaactgatgaagaa
ctggcagactggaagagaagacagcaaattgcctgcatcggaggcccaccaaacatctgc
ctcgatcgcctcgaaacatggatcacatccttggccgagtctcagctccagattcgtcaa
cagatcaagaagctggaggagcttcagcagaaggtgtcctacaaaggagaccccatcatt
cagcaccggcccgccctggaggaaaagatcgtggacctgttcagaaacctgatgaagaat
gcctttgtggttgaaaggcagccgtgtatgcccatgcatccagacaggcctctggtcata
aaaacaggagtgcagttcacaactaaagtcaggttactggtaaagtttcctgaactcaat
taccagctgaaaattaaagtctgcattgacaaagaaactggggatgtagctgcaatcaga
ggagcacgaaagtttaacatccttggcactaacacaaaagtcatgaacatggaggagtct
aacaacgggagcctttcggcagagttcaaacacttgaccttacgagaacaaagatgtggc
aacggtggccgaaccaatagcgatgcctctctgattgtaacagaggaactccacctcgtc
acctttgagacggaagtctaccatcagggcctgaaaatagatctggagactcattcgctg
cctgtggtagttatttcaaacatctgccagatgcccaacgcctgggcgtccatcctgtgg
tacaacatgctcaccaatcacccaaagaatgtgaacttcttcaccaagcctccagtgggg
acctgggaccaggtggctgaggtgctgagctggcagttctcctcaaccacaaagagaggc
ctgaccatcgagcagctgaccaccctggctgagaaactacttggaccctgtgtcaactac
tctggatgccaaataacgtgggccaagttctgtaaggaaaacatggctggcaaaggcttc
tccttctgggtatggttggacaacatcatcgacctggtgaagaagtatatccttgcactg
tggaatgaagggtacatcatgggttttatcagcaaggagagagagagagccattctgagt
ccaaagcctcccggcactttcctgctgcgcttcagcgagagcagcaaggaggggggcatc
acatttacatgggtggaaaaggacatcggtggaaagactcagatccagtcagtggagccg
tacaccaagcagcagctcagcagcatgtctttcgctgacatcatcatgggctacaagatc
atggatgccaccaacattctggtttcccctctcgtttatctgtaccctgatattcccaaa
gaggatgcttttgggaaatactgcaggccagaagcagctcatgaaccagaggctggtgga
gactcgatgagcattacccagccatatttgaagacaaagttcatctgcgttaccccgtgt
ccctccgtgttcatggacttgccagacagtgagctgcttgggaacggattcccaggcacc
aactctggaaacaccagcgacctgttcctcatgtctcctcgcactctcgactccctcgac
tccctgatgcccagcgacgctgaagccaaccaaggacctttggattcgatcactctgaac
atggatgttgcatctcctatgtga

DBGET integrated database retrieval system