KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243848Help
Entry
108243848         CDS       T05608                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00010  Glycolysis / Gluconeogenesis
kmr00030  Pentose phosphate pathway
kmr00051  Fructose and mannose metabolism
kmr00052  Galactose metabolism
kmr01100  Metabolic pathways
kmr01200  Carbon metabolism
kmr01230  Biosynthesis of amino acids
kmr03018  RNA degradation
Module
kmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108243848
   00030 Pentose phosphate pathway
    108243848
   00051 Fructose and mannose metabolism
    108243848
   00052 Galactose metabolism
    108243848
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    108243848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kmr01009]
    108243848
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kmr03019]
    108243848
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     108243848
Protein phosphatases and associated proteins [BR:kmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108243848
Messenger RNA biogenesis [BR:kmr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     108243848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 108243848
NCBI-ProteinID: XP_017285031
LinkDB All DBs
Position
Unknown
AA seq 807 aa AA seqDB search
MTGPMAPQRQDTRKFVENLSGAGKSIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITN
LCVIGGDGSLTGANLFREEWSGLLNELQEEGLIDEEAVHNHSELHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDCHNKAITPDYIKDLVVSHLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASTNTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFEEAVRLRGRSFENNLSTYRLLASRKADSELPNGEEEKKSGDEEQC
NSSFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEISWGDVG
GWTGQGGSLLGTKRTLPGKHLEKIAEQIRIHNINALLVIGGFEAFESLLQLYEARAHYQE
FCIPMCILPATISNNVPGTDLSLGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYC
GYLATVGGLAAGADTVYIFEEDFDIRDLQNNVEHLTQKMKTSIQRGLVLRNENSNENFTT
DFIYQLYSEEGRGVFDCRKNVLGHMQQGGTPSPFDRNFGTKVAAKAIQWITRMLKESYKG
GRVFTNSEDSACLLGMRRRAMVFQPVAQLQEETDFVHRIPKEQWWLKLRPVMKILAKYKT
SYDMSDSGQLEHVTQVRPKESDFSAAI
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtcccatggcaccgcagcggcaggacacccgcaaatttgtggagaatctgtcc
ggagccgggaaatccatcgcggttctgacgagcggcggagatgctcaaggtatgaatgca
gcggtccgggccgtggtccggatggggatctatgtgggagcaaaagtttacttcatccac
gaggggtaccaggggatggtggacggtggagacaatatcaaagaggcgacgtgggaaagc
gtctccagcatgctgcaagtgggtggcacagtcatcggcagcgctcgctgcaaagagttt
cgaacccacgagggacgcctgaaagctgctcacaaccttgtgcagcgcggcatcaccaac
ctgtgtgtgattggtggagacggcagcctgacaggcgccaacctgttcagggaggagtgg
agcggcctgttgaatgagctccaggaggaaggtctcatagacgaggaggcagttcacaat
cattctgagctccacattgtgggcatggtcggctctattgacaacgacttttgtggcaca
gacatgacaattggcaccgactccgccctccatcggatcattgaggtggtggatgccatc
atgaccacggctcagagccaccagaggacgtttgtgttggaggtcatgggcagacactgc
ggatacctggctttagtcagtgccctggcctgtggagcagactgggtctttattccagaa
atgcctccggaggatggctgggaggacaacatgtgtcagaaactgtctgagaaccgtgct
gataagaaaaggctgaacattattattgtagctgagggtgccattgattgccacaacaag
gcaataaccccagattatatcaaggatctggtagtgagccacctgggttttgacaccagg
gtcaccatcctgggccatgttcagagaggtgggaccccatctgcctttgataggatcttg
gcaagtcgtatgggagtggaggcagtgctggcgttactggaggcgtctaccaacacccca
gcctgcgttgtgtctctggttgggaaccaggctgttcgactaccacttatggagtgtgtt
cagatgacccaggaggtgcagaaggccatggatgagaagaagtttgaagaggcagtgagg
ctgcgcggcaggagctttgaaaataatctgagcacctacagactgctcgcctcccgcaaa
gcagattctgaactcccaaatggggaggaagagaagaaatcaggggatgaagagcagtgt
aacagctcctttaatgtggcggtgttgaacgtcggcgcgccggctgcggggatgaatgcc
gccgtgcgttcggctgtcagggtgggaatcactgaaggtcacaaaatgtttgctgtgaac
gacggcttcgaggggttctacaaaggccagatcaaagagatcagctggggagatgttgga
ggatggactggacagggggggtctcttctgggcacaaaaaggactcttccaggaaaacat
ctggagaaaatagctgaacagataagaatccataacattaatgctctgctggtgattgga
ggatttgaggcctttgagtccctgctgcagctgtacgaggcccgggcccactaccaggag
ttttgcatccccatgtgcattctgcctgccaccattagtaacaatgtgccaggcactgac
ctcagtcttggagccgacacgtcactcaacgccattgtggagacgtgtgaccgcatcaag
cagtccgccagcggcaccaagcggcgggtcttcatcattgagacgatggggggttactgt
ggctatctggccacggtgggcggtctggctgcaggtgccgacactgtctacatctttgag
gaggactttgacatccgtgatttgcagaacaacgtcgaacatctgacgcagaaaatgaag
acgagcatccagagaggcttggtgctccgaaacgagaactccaacgaaaacttcaccact
gacttcatctaccagctgtactctgaggaaggtcgaggcgtgttcgactgcaggaagaac
gtcctgggtcacatgcagcagggaggaactccatctccttttgacagaaactttggcacc
aaagttgcagctaaagccattcagtggatcacacggatgctcaaagagtcctacaaagga
gggagagtctttaccaactcggaggacagcgcctgtctgttggggatgcgtcgcagagcg
atggtcttccagcctgtggctcagcttcaggaggagacagactttgtccacaggatccca
aaggagcagtggtggctgaaactccgtcccgtgatgaaaatcctggccaagtacaagacg
agctacgacatgtccgactcgggccagctggagcacgtgacccaggtccgacccaaagag
agcgacttctctgctgcgatctga

DBGET integrated database retrieval system