KEGG   Kryptolebias marmoratus (mangrove rivulus): 108245038Help
Entry
108245038         CDS       T05608                                 

Gene name
mgst1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00480  Glutathione metabolism
kmr00980  Metabolism of xenobiotics by cytochrome P450
kmr00982  Drug metabolism - cytochrome P450
kmr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108245038 (mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108245038 (mgst1)
   00982 Drug metabolism - cytochrome P450
    108245038 (mgst1)
   00983 Drug metabolism - other enzymes
    108245038 (mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmr02000]
    108245038 (mgst1)
Enzymes [BR:kmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108245038 (mgst1)
Transporters [BR:kmr02000]
 Other Transporters
  Pores ion channels [TC:1]
   108245038 (mgst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 108245038
NCBI-ProteinID: XP_017287152
LinkDB All DBs
Position
Unknown
AA seq 151 aa AA seqDB search
MAQLMEDEVFRAFTTYAAIVTLKMMLMGPMTAYFRITRGSFTNEEDVARKSEEEKKKLLK
SHPDVERVQRCHHNDLENVVPFFFIGLLYALTGPELSTALLHFRAFTAFRIFHTIAYINA
LPQPSRGLSYILGTLVMFSMAYRVLSTVFVL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctgatggaagacgaggtcttcagggccttcaccacctacgctgccattgtc
accctgaagatgatgctgatggggccgatgactgcgtatttccggatcacccgagggtcc
ttcaccaacgaggaagatgttgcccgaaagtctgaggaggagaagaagaagctgctgaaa
tctcatccagatgtggaacgagttcaaaggtgtcaccacaacgacctggagaacgtcgtc
cccttcttcttcatcggcctgctgtacgctctgactggaccagaactttccaccgccctg
cttcacttccgcgcgttcacggccttccgcatcttccacaccatcgcctacatcaacgcc
ctgcctcagcccagccggggcctctcctacatcctcggcacgctggtcatgttctccatg
gcgtacagggtgctcagcacggtcttcgtcctgtag

DBGET integrated database retrieval system