KEGG   Kryptolebias marmoratus (mangrove rivulus): 108245317Help
Entry
108245317         CDS       T05608                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00010  Glycolysis / Gluconeogenesis
kmr00051  Fructose and mannose metabolism
kmr00052  Galactose metabolism
kmr00500  Starch and sucrose metabolism
kmr00520  Amino sugar and nucleotide sugar metabolism
kmr00524  Neomycin, kanamycin and gentamicin biosynthesis
kmr01100  Metabolic pathways
kmr01200  Carbon metabolism
kmr04910  Insulin signaling pathway
Module
kmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kmr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108245317
   00051 Fructose and mannose metabolism
    108245317
   00052 Galactose metabolism
    108245317
   00500 Starch and sucrose metabolism
    108245317
   00520 Amino sugar and nucleotide sugar metabolism
    108245317
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108245317
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108245317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108245317
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108245317
Membrane trafficking [BR:kmr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108245317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108245317
NCBI-ProteinID: XP_017287610
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDDTLKDIKNRFRREMENGLGRDTNPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESHTYDTPDDIIH
GSGTQLFDHVADCLGDFMDKQKIKDKRIPVGFTFSFPCVQNKLDEAVLVTWTKKFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVQHVCTIVSFRSANLISATLGAILSRLKDNKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSSKGAAMVTAVAYRLTEQARQIQQTLAEFRLS
KNQLLEVKKRMRLEIERGLKKDTHKEATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCYQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEMEEPEFELDVVAIVN
DTVGTMMTCAYEEPTCEIGLIAGTGSNACYMEEMKNIEIVPGNEGRMCVNMEWGAFGDNG
CLDDIRTIYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGA
GMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSRIFLQTVKELAPKCDVNFLLSEDG
SGKGAALITAVGCRQRELDAQHH
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcactgagctgaaggatgatcagctcaag
aagattgataagtacctgtactccatgcgtttctctgatgacacactaaaggacatcaag
aaccgcttccgcagggaaatggagaatggacttggccgtgacacaaaccccactgctgcc
gtcaagatgctgcccacctttgtcaggtccatccctgatggatcagaaaaaggagatttc
attgctctggatcttgggggttcaaactttcggatcttgcgtgtcaaagtgacacaagac
aagaagcaaccagttcagatggagagccacacttatgacactcctgatgacatcatccac
gggagcgggacacagctctttgaccatgttgctgattgcctcggtgattttatggataaa
cagaaaattaaggataaaaggatccctgtgggttttacgttttcattcccctgtgtccaa
aacaaactggatgaggctgtcttagtgacatggacaaagaagtttaaagccagtggtgta
gagggcatggatgttgtgaaactcctgaacaaggcgattaagaagcgtggggactacgaa
gcagatatcatggcagtcgtgaatgataccgtcggcactatgatgacatgtggatttgat
gatcagcgttgtgaagtgggaatcattataggaactggaacaaatgcctgctacatggag
gaactgcgtcacattgacttggtggaaggggatgaaggccggatgtgcattaacactgag
tggggtgcctttggggacgatggctccttagaggacattcgcacagagtttgaccgtgag
attgacagaggttctctcaacccagggaagcaactgtttgaaaagatggccagtgggatg
tacatgggagaacttgttcgactcattctggtcaaaatggccaaagaggggctgctattc
gagggacgaataacccccgagctcctgaccaaaggaaagattgagactaaacatgtctct
gccattgaaaagactaaagaaggtctgaagaaatgtatggagatcttgacgaggcttggt
gtggagccttcagatgaggactgcctggctgtgcagcatgtatgcaccattgtttccttc
cgctcagcaaatctaatttcggcaactctgggagccatcctttcacgcctaaaggataac
aaaggagttgctcgtcttcgcactaccgtgggaattgatggttctctctacaagatgcat
cctcaatatgctcgccgcctgcacaagacagttcgtcgtttggttccagactccgacgtg
cgcttcctgctgtctgaaagtggcagcagcaaaggcgccgccatggtgacagcagtggca
taccgtttaacagagcaggcacgccaaatccagcagactttggcagaattcaggctgagc
aaaaatcagctgttagaagtgaaaaaacgcatgagattggaaattgaaagaggcctaaag
aaggacacccacaaggaagctacagtcaaaatgctgccgacttttgtacgaagcacaccg
gatggaacagaaaatggagactttcttgctctggaccttggaggaacaaacttccgtgta
cttctggttaagattcgtagcggaaagagacgatcagtggagatgcataataaaatctat
gccattccaattgaagtgatgcagggcactggagaagaactttttgaccacattgtgcac
tgcatttctgacttcctggactacatggggatgaaaagtgctcgacttccactgggattt
accttctccttcccctgttatcaaaccagcctggatgcaggtattttggtaacctggaca
aagggcttcaaagcaacagactgtgagggtgaagacgtcgtagagcttctgagggaagcc
atcaagagaaaagagatggaagaaccagaatttgaactggatgtggtggccatagtgaat
gacacggtgggaacgatgatgacttgtgcatatgaggaacctacttgtgaaattggactg
attgcaggcacaggaagtaacgcctgctacatggaagagatgaaaaacattgagatagtg
ccgggaaatgagggtcgtatgtgtgtgaacatggagtggggggcctttggagataatggc
tgcctggatgacatcaggacgatttacgatcaggcagtggatgagaactcactcaatgaa
ggcaaacaaagatatgagaagatgtgcagtggaatgtacctgggtgaaattgtgcggcag
attttaatcgatctaaccaagcgtggtttcctcttccggggacaaatctcagagactctg
aagaccagaggtatctttgagacaaagttcctgtcacaaatagagagtgatcgtctggca
ctgctgcaagtcagggcaatcttacagcagctgggactcgacagcacctgtgatgacagt
attattgtcaaggaggtgtgtggcacagtgtcccgccgtgccgcgcagatctgtggagcc
ggcatggctgctgttgtggacaagatccgtgagaacagaggactggaccacttggacgtc
accgtgggcgttgacggcaccctctataagctgcacccacacttctctcggatcttcctg
cagacagtgaaagaacttgctcccaaatgtgatgtcaacttcctgctgtctgaggatggc
agtggtaagggagctgctctcatcactgccgtgggctgccgccagagagagctggatgca
cagcatcactga

DBGET integrated database retrieval system