KEGG   Kryptolebias marmoratus (mangrove rivulus): 108245897Help
Entry
108245897         CDS       T05608                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
Enzymes [BR:kmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108245897 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108245897
NCBI-ProteinID: XP_017288638
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MSDKEATLTPSPAPPAPTGRPPKVNNRGRSSVPIASSNSETTDIPELEYFGVPGPRGYPP
LTNFLDIWDVDMMKKPNESNKTDHHTKFYNSNNLIVRRGQEFQVKVTFSRPYKPNEDKFA
LEFVIGSSPDYSKGTYIPVFPTKDRQSSWEGRITETNNNMVTMGIIPKADCIVGKYQMFV
AVLTPFGVRRTKRDPSRDLYILFNPWLAADAVFLDDEEERQECVMNEIGIIYHGAYDDIS
ERNWNYGQFNHGVLDACLYIMDRSEMPITNRGDPVKVTRKASAMLNSRDDEGVLVGNWSG
DYTYGVAPTSWTGSTDILLSYASSKMPVCYAQCWVYAAVFNTFLRCLGIPARVVTNYFSA
HDNDGNLKTDVILDDNGRIDRKLTKDSIWNYHCWNECYMSRPDLPPGFGGWQVVDATPQE
TSDGMYRCGPASVHAIKHGQICYPFDAAFVFAEVNSDCVFYSRRNDGTMQPVKVNRTHIG
RMVLTKAVGDVTRRDITDQYKFPEGTPEERTVLEKAEEYGCKGEKSNPPLADVDIVLPTM
EISVGDDFDLNLEFTNRSDQQRTVEAYVSGSVVYYTGVASHEFLFETPTVTIQPKTSVKE
LVIVESRDYMDHLVDQANLHFIVTGKIKETSQIVTAMKIVTLHNPKLIVEVSGSNKVSEE
MIATVHFTNPFTHNLENVYIRMEGPGVMLPVKKYYSLIPGGSSLTCTENFRPQRAGSTRV
IATLDCSGLRQVSGQASINVEA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaagaagccaccctgaccccgtctcctgctccccctgctcccaccggtcgt
cctcccaaggtgaacaaccgaggccgctcctcagttcccatcgccagctccaactctgaa
acaacagacatccctgagttggagtacttcggtgttcctggtcccagaggatatcctcct
ttgacaaattttctggacatctgggatgtggatatgatgaagaagcccaatgaaagcaat
aagactgatcaccacaccaagttctacaactccaacaatcttattgttcgacgaggacaa
gagttccaggtcaaggtcaccttcagtcgtccctacaaacccaacgaggacaagtttgct
ctggagtttgttattggatccagcccagactacagtaagggcacctacattcctgtcttt
cctacaaaggatcgtcagagctcctgggaaggccgcatcacagaaaccaataacaacatg
gtcaccatgggcatcatccctaaagcggactgcattgtggggaaatatcaaatgtttgtc
gccgtgctgacgccttttggcgtccgcaggactaaacgagaccccagtcgagatctttac
atcctttttaatccctggttggcagctgatgctgtgtttctggatgatgaagaagagagg
caagagtgtgtgatgaatgagatcgggatcatctatcacggcgcctatgatgacatctct
gagagaaactggaactatggacagttcaaccatggggtgctggatgcgtgtctgtacatc
atggacaggtctgagatgcccatcaccaacagaggagaccctgtcaaggtgaccagaaaa
gcctctgccatgctaaattcccgtgatgatgaaggagtgttggtggggaactggagtgga
gactacacctatggggtggctcctacttcctggaccggcagcactgacatcctgctcagc
tatgccagcagcaagatgcccgtctgctatgctcagtgctgggtctatgctgccgtcttc
aacaccttcctccgctgtctgggtatcccagctcgagtcgtcaccaactacttttctgct
cacgacaatgatggaaacctaaagaccgatgtaatcctggatgacaatggcagaattgat
cgaaaactcaccaaggattctatctggaactatcactgctggaatgagtgctacatgtcc
agaccagacctccctccaggttttggaggctggcaggttgtggatgcaacaccacaggaa
accagcgacggcatgtaccgatgtggacctgcatcagtccacgccatcaaacatggacag
atttgctatccatttgacgcagcctttgtgtttgcagaagtgaacagcgattgtgtgttt
tattctcggaggaatgatgggaccatgcagccggtcaaagtgaaccgaactcatataggt
cgcatggttttgaccaaagctgtgggagacgtgactcgtcgcgacatcactgatcaatac
aagtttcctgaagggaccccagaggagcgaacagtactggagaaagcagaggaatacggc
tgtaaaggggagaagtccaacccgcccctggctgatgtggacatagtcctgccaaccatg
gagatcagcgttggcgatgatttcgacctgaacctggagttcaccaaccgcagtgaccag
cagcgcacagtggaggcctacgtcagcgggagtgtggtgtattacaccggagtcgccagc
cacgagttcctctttgagacccccactgttacaattcagccaaaaacaagtgtgaaggag
ttggtgattgttgagtcaagagactacatggatcatctggttgatcaggctaatcttcac
tttatcgttactgggaagatcaaagaaaccagccagatcgttaccgcaatgaaaatcgtc
accctgcacaacccaaaactcatcgttgaggtgtctggcagcaacaaagtgagtgaggag
atgattgcaactgtgcactttacaaaccccttcactcataatcttgagaatgtctacatt
cgtatggaaggaccaggggtcatgctgcctgtaaagaaatattacagtctgatcccagga
ggctcctctctgacctgcaccgagaatttcaggcctcagagggccggcagcaccagagtg
atcgctactttggactgttctggtctgagacaggtctccggccaggcgtccatcaacgtc
gaggcttga

DBGET integrated database retrieval system