KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246150Help
Entry
108246150         CDS       T05608                                 

Gene name
map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04210  Apoptosis
kmr04625  C-type lectin receptor signaling pathway
kmr04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108246150 (map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108246150 (map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108246150 (map3k14)
   04672 Intestinal immune network for IgA production
    108246150 (map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108246150 (map3k14)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108246150 (map3k14)
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: STE group
  Other
   108246150 (map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal CCDC106
Motif
Other DBs
NCBI-GeneID: 108246150
NCBI-ProteinID: XP_017289042
LinkDB All DBs
Position
Unknown
AA seq 842 aa AA seqDB search
MAVRQRFFNSTEPFSGLPKAELKGSYPSCSSTEQETEEEEEEGKDTKKGYLPVPEWGAIP
HINKLITRGTAEQVGESPVKTSTIIAQAECETQGTQEFIPSCFKPSFVPSPNCFTSSLSS
EHNNVACPTTASVQEPSSVSGSHTQRKKNRRRQKSKGKKRQEKRKETQRQRHRTPSGVPE
QESGSSVGLIQEESSLGGRSDLSTSCCGSIESSVEQDRGHPLYTRPIYNTNWPNPVLCPL
STFQSYEQDRSSDSLSSLGDCSLALAGLRGSVSQGDPCYAGPFFKDVESEVMESEDESSL
DDSECNEGIIFYNDKIQLMDSEYKEGREYVLSQFIKQGSYGEVHSAQDLNTGFKYAIKKI
HLKRFSSEEVGAWSTLRSPRVVELFGVIRNGPHVLLLMDQKSKSLSQLIVERGRLPEDLS
LHFFFQVLTGLEYLGKKRVAHLDIKADNVLLSEDGRDTFLCDFGHAEKLDNQGWSLSGSK
DLKGTETHMAPEIVKGEPRGAKADVWSSCCMLLHMLSGCQPWTRYYSCILYLKIANEPPP
LREIPPDCSPFTAEVLKAGLQKDPVKRSSATQLKEKTDRALKEVGGLTSPVQGPFTEPLY
AVSKLPDSLRLSNSSDEFVDKEDHLDSAEKVITAGLNTQKLPPGPQPLIAEPSQKWRDKI
TAVLDDECRKLERDFCLNSLSQLHSAEEQEQLLSCIKSDPSIWEPREKKDSGRWSLSPGD
DFSSGFFSYNSQPDVQALSMDLLGHTPSPPPWCFEGVDVSIRSFSGRSIRIREKRRVKVS
HIATGISDQISERVFTLETLQRQQVAHDEEVLESGLELCCVPAPDFSPAWRWRIRDGVLE
MR
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcagaggtttttcaactcaacagaaccgttttccggcttgcccaaagcc
gagctgaaggggtcttacccgtcctgctccagcacggagcaggagacggaggaggaggaa
gaggaggggaaggacacaaaaaaaggctacctgcctgtcccggagtggggtgcaattccc
cacattaataaactcataacacgagggaccgcagaacaagtgggcgaatcgccagtaaag
acctcaaccatcattgctcaggctgaatgtgaaacccaggggactcaggagtttattccc
tcttgcttcaaaccctcttttgtaccctccccaaattgtttcaccagcagtctttcctcc
gagcacaacaacgtggcgtgcccgaccacagcctccgtccaggagcccagcagcgtttcg
ggcagtcacacgcagagaaagaaaaaccggaggaggcagaagagtaaggggaagaaaagg
caggagaagaggaaggagacgcagcggcagagacatcgaacgccgtctggagtccctgaa
caggagagtgggagctctgtaggcctgatccaggaggagtcgtctctcggaggcagaagc
gacctcagcacgtcctgctgtggcagcattgaaagctcggtcgagcaggatcgaggacat
cctctctacaccagaccgatctacaacaccaactggcccaacccggtcctgtgccccctt
tccaccttccagtcatacgagcaggaccgaagctccgactcgctcagtagcctgggagac
tgctccctcgccctcgctggcctcaggggcagcgtcagccagggggacccgtgctacgca
ggtccctttttcaaagatgtggaaagtgaagtaatggagagtgaggatgagtcctcctta
gacgattcggagtgcaacgaaggaatcattttttacaatgataaaattcagctcatggac
tcggagtacaaagaagggagagaatacgtcttatcacagtttatcaagcaaggttcctat
ggtgaagtacacagtgctcaagatctcaacacaggattcaaatatgcaatcaaaaagatt
cacctgaagaggttcagcagtgaggaggtgggtgcgtggagtaccctcagatctcctcgg
gtggtggaactcttcggagtcatacgaaatggacctcatgtgctccttttgatggaccag
aaatctaagtctttgagtcagctcatagtggagcgcggtcgactgccagaagatttaagt
ctccacttcttctttcaagttctaacggggctggaatacttggggaagaaacgggtggcg
catttagacattaaagctgacaacgtgttgctctcagaggacgggagagacaccttcctg
tgtgactttggacatgcagagaaacttgacaatcagggttggagcctcagtgggtccaaa
gatctaaaaggaacagagactcacatggcccctgagatcgtaaaaggggaaccccgcgga
gccaaagcagatgtgtggagcagctgctgtatgttactgcacatgcttagtgggtgtcaa
ccttggacaagatactactcctgtatactctacctgaagattgcaaatgagcccccacct
ctcagagagatcccacctgactgcagccctttcacagctgaggttttaaaggctggactc
cagaaggatccagttaagaggtcatcagcgactcagctcaaagaaaaaacagacagagcg
ctgaaagaagttggaggactcaccagtccagtccagggtcccttcacagagcctctgtat
gctgtcagcaaactgcccgactccttgcgactcagtaatagcagtgatgagtttgtcgac
aaagaggaccacctggattccgctgaaaaagtgatcacagcgggattaaacacacagaaa
ctgcctcctggtccacaaccgctgatcgctgagccaagccaaaagtggagagacaagatc
accgccgtgttggacgatgagtgtcgtaaactggagcgagacttctgcctgaacagcctg
tctcagcttcattctgctgaggagcaggagcagctcctgtcttgtatcaaaagtgatcct
tctatctgggaaccgagggagaaaaaggactcgggccgctggtctctgagcccaggagac
gacttcagctccggcttcttctcctacaacagtcaaccagatgtgcaggcgctcagcatg
gatttgctgggccacacaccatctccaccaccttggtgttttgaaggggtggatgtctcc
atcaggagcttcagcgggagaagcattagaatcagagagaagcgtcgagtgaaggttagc
cacatcgccactggaatcagcgatcagatctctgagcgggtgttcactctggagaccctg
cagcgccagcaggtcgctcacgacgaggaggtgctggaatctggtctggagctctgctgt
gttcctgctccggacttcagccccgcatggaggtggaggatcagagacggagtgctggaa
atgagatag

DBGET integrated database retrieval system