KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246380
Entry
108246380         CDS       T05608                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04141  Protein processing in endoplasmic reticulum
kmr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108246380
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108246380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108246380
Transcription factors [BR:kmr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108246380
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf
Other DBs
NCBI-GeneID: 108246380
NCBI-ProteinID: XP_017289381
LinkDB
Position
Unknown
AA seq 680 aa
MEEGEDADFSQGLNYDTLFDNDLVLTLDPDNRTSPWQHLDNNLLTGNTSVVKNEMTITKP
LPVEMLFQIKAEPPSPASSLESDCSVSSPDSQVTVKGENPPTPPYMYGDVLSPPLGTMEV
TVATTAVPPPQTQMPTVAQTQLQTSLTTSVPAVIGGIQTQAAVLPSSTTLKASTILSTKP
PIQPRPVCVTTLPVPQNPTPAKTLILQSLPSMDQTRPVVLSPSVCLSSAPAIVKMEPVSP
SIPQHCSSPAAATSSSSKPIVPATTPLPGNNSSDIDMKVLKRQQRMIKNRESACQSRKKK
KEYLQNLEAQLREAQQENERLRRENQALRERLAGKEGGDSASNKRAVCVMAVLLFMTFSF
GPISITDRKLSDDLQEDVMSFTGRRLLEIEQQQQQQQQAAAQPPSKVEDKTEMEEDGGEA
ERFAPESFQFRNLSGMFSDMKDLALQELDRYFTSSDCRQFNRSESLRLADELRGWVHRHQ
IDRKKSGGKPKIAKKAKITQKAQLRKTNFSRYLPIQAHGSIESHLKVLPGPEVTYSDFLD
AIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAVNESLYNSSQGYEMMMQV
DCEVMDTRIVAIKSSAVPPSLRDPTPPPPSSQHNAHHHHGNNTSLRGRHQHHSSSSSSSR
QPLPARRQAPEYLISQSDGV
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggaggagggggaggacgcagacttcagtcaggggctgaactacgacacattgttcgac
aatgacctcgtgctcacccttgatcctgacaaccgcacgtcgccatggcaacacctcgac
aacaaccttctcacaggaaacacgtcggtggtaaaaaacgaaatgacgataacgaagcct
ttacctgtggaaatgttgttccagataaaagcagagcctccgtccccggcgtcctcgctg
gagtcggactgctcagtctcttcccccgactcacaggttacagttaaaggtgaaaaccct
ccaactcctccatacatgtacggagacgtgctgtcccctccgctggggacgatggaggta
accgtggcaacgacagcagtaccccctccgcagacccagatgcctacggtggcacagaca
cagctgcagacgtccctaacaacatctgtcccggccgtcatcggtggaatacagactcaa
gctgcagtccttccgagttcaacaaccttaaaggccagcaccatcctcagcaccaaacct
cccatccagccccgaccggtgtgtgtcaccaccctccccgtcccccagaaccctacaccg
gccaagaccctcatactacagagcctcccctccatggaccagaccagacctgtcgtcctc
tctccatccgtctgcctcagttcagctccagctattgtcaaaatggagcccgtctctccc
agcatcccccagcactgctccagcccagctgctgccacctcctcttccagcaaacccatc
gtcccggcaaccacaccgttaccaggcaacaactccagcgacattgatatgaaggtgctg
aagcggcagcagaggatgataaagaacagagagtccgcctgccagtcaagaaagaaaaag
aaggagtatctgcagaacctggaggcccagctgagggaggcccagcaggagaatgagcgg
ctccggagggagaaccaggcactgagggagagactggccgggaaggagggcggcgactct
gcaagtaacaagagagccgtgtgtgtcatggccgtcctgctgttcatgaccttcagcttc
ggacccatcagcatcacagacaggaagctgtcggacgacctgcaggaagacgtgatgtcg
tttacggggcgccggctgctggagatcgaacagcagcagcaacagcagcagcaggcggca
gctcagcctcccagcaaagtggaggacaagacggagatggaggaggacggaggagaggca
gagagatttgctccggagtcttttcagttccgaaacctgagtggcatgttcagtgacatg
aaggacttggccctgcaggaactagaccgttacttcacctcctcagactgccgacagttc
aaccgctccgagtctctcaggctggcggatgagctgagaggctgggttcatcgacatcag
atcgacaggaagaagtctggaggaaaaccaaagatcgccaagaaggcaaagatcacgcag
aaagctcagctgaggaagacaaacttctccagatatctgccgatccaggctcacggctcc
atcgagagccacctgaaggtacttcctggtccggaggtcacctacagcgacttcctggac
gccattgatcgcagagaggacaccttctacgtcgtctccttcaggcgggaccacctgctg
cttcctgccatcagccacaacaaaaccagccggcccaagatgtctctggtgatgcccgcc
atggcggttaacgagagtctctacaactcgtctcagggctacgagatgatgatgcaggtc
gactgcgaggtcatggacacccggatcgtcgccatcaagtcgtccgccgtccccccgtcc
ctccgtgaccccaccccgcctcctccctcctcgcagcacaacgcccaccatcaccacggc
aacaacacgtcgctccgaggacgccaccagcaccactcctcctcgtcatcatcttcacgg
cagcctctacctgcccgcagacaggcgcccgaatacttgatcagtcagtcggacggggtc
tga

DBGET integrated database retrieval system