KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246606
Entry
108246606         CDS       T05608                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04012  ErbB signaling pathway
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108246606
   04068 FoxO signaling pathway
    108246606
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108246606
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108246606
NCBI-ProteinID: XP_017289734
UniProt: A0A3Q3BDY6
LinkDB
Position
Unknown
AA seq 204 aa
MTTGRSRVFKNCVLFGCGNNNKSNRRKMSGVRLSNGSPTLERTESRVTEHPKPSACRNLF
GAVDHEQLSKDFNAHMRELEEAAAAKWGFDFVNDTPLPNSNNGRFKWEVVDSRELPDFYA
PQPRRDTGGVDVNGNRRCVLAAPGEDTGRSDGQTGCTGLRKRPACHDPSAQSKRSHTSPD
EVSCSSLSHSVEHTPRKPSPKRQT
NT seq 615 nt   +upstreamnt  +downstreamnt
atgacaactggacgctcccgggtgtttaaaaattgcgtcttattcgggtgtggaaataat
aataagagtaatagaagaaaaatgtcaggcgtccgactttcgaatgggagcccgacgttg
gagcggacggagtcccgggtgacggagcacccgaagccgtccgcctgccggaacctcttc
ggcgcggtggatcacgagcagctgagcaaggattttaacgcgcacatgcgggagctggag
gaggccgccgccgccaagtggggcttcgacttcgtcaacgacacgccgctgcccaacagc
aacaacgggaggttcaagtgggaagtagtggattccagggagctcccggacttctacgcc
ccacagccgcggagggacaccggcggcgtggacgtgaacgggaaccgccgctgcgtgctg
gcggctcccggcgaggacaccggcaggtccgacggtcaaacggggtgcaccgggctgagg
aagagacccgcctgtcacgacccctcagcccagagtaagaggtcccacaccagcccggac
gaggttagctgttcgagcctgagccactctgtagaacacacacccaggaagcccagtccc
aagagacagacgtga

DBGET integrated database retrieval system