KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246814Help
Entry
108246814         CDS       T05608                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 3A-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:kmr04040]
    108246814
Ion channels [BR:kmr04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   108246814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 108246814
NCBI-ProteinID: XP_017290028
UniProt: A0A3Q3A737
LinkDB All DBs
Position
Unknown
AA seq 535 aa AA seqDB search
MLTDLTAMRFAGLCFLLLLTGGSTSELQQQTDDGPESVQSFEEMPGGNFSELEPSGDFWD
EPELHLMPNSVDMSFMENPDPEHFPQIFEHIRENEPNISEECSFQAVLNHLKLTKSSNKY
IMSRPVKHHNHLTWILLEMKIYSILDVRETDQTFISYIWVYLRWDNEHIWWDPNQFCGID
HILVPTQYLWMPDLTIEEMTEQDKASPSPYFNIRSYGWVEFRNDQVVISSCKMRVYKFPF
DVQSCNISFKSIMHSDEEIKLFYHKNNTEITERSRESIQTQYEWVFVNMTVTSKTVKHFG
FNQTMIVYTINMQRRSVLYIANFLLPILFFLCLDFASLLMSDTGGDKIGFKITVLLAVTV
MQLILNDILPSSSDKIPLIAVYCIGIFGLMLLSLLETILVMHLIDKDASQDNEPTKNQSL
NEGNESNQNNSRRCFLGTMKQSGCASVNNKSADGTPSEVPNSQCTEVSLTLEKLSDELGE
IRETLALLSCGKEDQKPSYWTGVAQKINKAFAIFYVITATLFLLTIFTMWYFADE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcactgatctcacagcgatgaggttcgccgggctctgttttctgctcctccttaca
ggtggatcaacttcagagctgcagcaacaaacggatgatggaccagaatcggttcaaagc
tttgaagaaatgccaggtggaaatttctctgaactagaaccttctggcgatttctgggac
gaaccagagcttcacctaatgcccaactcagtagatatgtcatttatggagaacccagat
cctgaacattttcctcagatttttgaacatattcgagaaaatgaaccaaatatttcagaa
gagtgtagttttcaggctgttttaaaccacctgaaactgaccaaaagcagcaacaagtac
attatgagtcggcccgttaaacatcacaatcatttaacgtggattctgctggagatgaaa
atctactccatccttgatgtgagagaaactgaccagactttcatttcatacatttgggtt
tatttgagatgggacaatgaacatatctggtgggatccgaatcagttctgtggaattgat
cacattttagttcccactcagtatttgtggatgccagatctgactattgaagaaatgaca
gagcaagacaaagcgtctccgagtccttatttcaacattagaagctacgggtgggttgaa
ttcagaaatgatcaagtggtgatcagctcatgcaagatgcgtgtttacaaattcccgttt
gacgttcagagctgcaacatctctttcaaatcaatcatgcactccgatgaggaaataaag
ttattctaccataagaacaacacagagatcacggagcggtctcgtgaatcgatacagacg
cagtacgagtgggtatttgtcaacatgacagtcacgagcaaaactgtcaaacattttggc
ttcaaccagacgatgattgtttatactataaacatgcagagaaggtctgtcctctacatt
gcaaacttcttgctgcccatccttttcttcctgtgtctggactttgcctccctcctgatg
tcagacactggcggtgacaagattggcttcaaaatcaccgtactgcttgcagtcacagtg
atgcagcttattctcaacgacatccttcccagttcgtcggacaagattccactaattgcg
gtttactgcatcgggatttttggtctcatgctgctcagcctcttggagacgattctggtg
atgcatctaattgataaagatgcatcccaggacaatgagccaaccaagaaccaaagcctg
aatgagggaaacgagagcaaccagaacaactcccgcaggtgttttctggggacaatgaaa
caaagtggatgtgcatctgtcaataataagtcagctgatggaaccccctcagaggttccc
aacagccaatgcactgaggtgtctcttaccttagaaaagctttcagacgagcttggggag
attagggaaacactcgctcttctcagctgtggaaaggaggatcagaaacccagctactgg
accggagtggctcagaaaatcaacaaggcttttgcaattttctatgtcataacagccact
ctgtttttattgaccatctttacaatgtggtattttgcagatgaatag

DBGET integrated database retrieval system