KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246858Help
Entry
108246858         CDS       T05608                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108246858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kmr01002]
    108246858
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108246858
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108246858
Peptidases [BR:kmr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108246858
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108246858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108246858
NCBI-ProteinID: XP_017290090
LinkDB All DBs
Position
Unknown
AA seq 299 aa AA seqDB search
MKEQSEQAVRLQCFSHLLWCEIVYSSAIMNLLMCLCCVLLDLATVHSRVFMQDRIVGGYT
AAPNSIRYMVSLQTTNGQHFCGGSLVHRYWVLTAAHCNIGADQMMIVAGDYRVNVFEGTE
QYAKPHRLVTHPLYNRSTNNADIMLIKLRAPVILNKFVALAPLPRQGTGVVEGQMCRVSG
WGYNSVGGGRVPVMLRTVTLPIVSAARCNSSHSFDGNITANMICAGYQAGGKDACKGDSG
GPLVCRGRVYGVVSWGNGCGDAKYPGVYTAVARFRRWVDQTVYGSYRHCSRYRWRLKRG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcagtctgagcaggcggtgaggctgcagtgcttcagccacctgctatggtgt
gagatagtctactcatcggctataatgaacctgcttatgtgtttatgctgtgtgcttctg
gacctagcaacagtccacagtcgtgtgtttatgcaggaccgcatagtgggcggttacacc
gctgcaccaaactccatcagatacatggtgtcgctgcagaccaccaacggccagcacttc
tgtggggggtcactagttcacaggtactgggttctgaccgcagcgcactgtaacatcggg
gcagaccagatgatgatagttgcaggcgactacagagtgaatgtgttcgagggcactgag
cagtacgctaaaccccacaggctggtcacccatccactgtacaacagaagcaccaacaat
gctgatatcatgctcattaagctgcgggcccctgtgatcctgaacaagtttgtggccttg
gctcctcttcccagacagggaacaggcgtggtcgaaggtcaaatgtgtcgggtgtctgga
tggggctacaatagcgtgggtggaggccgggtcccggtgatgctcaggacggtcacgctg
cccattgtttcagccgcgagatgtaacagcagccactcgtttgacggaaacattacggca
aacatgatctgtgctggataccaggctgggggaaaagatgcatgcaagggagactcgggc
gggccgctcgtgtgccggggccgggtgtacggcgtggtctcgtggggcaacggctgcggc
gacgcaaagtaccctggggtgtacacggccgtggcccgattccgccgctgggtagaccag
accgtctacgggtcgtaccgccactgctccagatacagatggaggttaaagcgtggatga

DBGET integrated database retrieval system