KEGG   Kryptolebias marmoratus (mangrove rivulus): 108247374
Entry
108247374         CDS       T05608                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 108247374
NCBI-ProteinID: XP_017290928
UniProt: A0A3Q2ZFN2
LinkDB
Position
Unknown
AA seq 354 aa
MSNCELIELKDLSVNDPIELAASALPTGRPSQPGHSHAVRLVGDRVTIEAPVCHTGEGAV
GHDFQPYNYTHLTWCDLCGEFIWGLFKQSLRCAHCSYTCHYRCRPFILLDCSTHGSVLMQ
KADYTEDSIETDTNVDEQIELGKQELSVGEIRQRVKEYNTQINNNLYMVVNKNGSYTGFI
KVHFQLLRPISLPPPQRQNSREEGDQQDRRIQRRTSFYLPKDAAKHLHISSETRVREVIE
ALLRKFTVVDNPAKFALFERTEKQSQVCMRKMSEDERPLFLRLCAGPSETVLSLVLKENE
TGEINWDAFSLPELGNFLRILQREEEEHVRQIVRRYAHARDMMKQAVARITTPG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtctaactgtgagctgatcgagctgaaggacctcagcgttaacgatcccatcgagctg
gcagcctccgccctgccgactggacgccccagccagcccggccacagccacgccgtccgt
ctggttggagacagagtcaccattgaggcgcccgtctgtcacacgggggagggcgccgtg
ggacacgacttccagccgtacaactacacacacctcacctggtgtgacctgtgtggagaa
ttcatctgggggcttttcaagcaaagtttgcgctgcgcccactgcagttacacatgtcac
taccgctgccgaccgttcatcctgctggactgcagcacacatggaagtgtgttaatgcag
aaggcagattacactgaagactccattgagaccgacacaaatgtggatgagcagatcgaa
ctgggtaaacaggaactgagtgttggtgagatccggcaaagggtgaaggagtacaacact
cagattaacaataatctctacatggttgttaataaaaatgggtcctatactggtttcatc
aaggtccactttcagctccttcgtcccatctccctccctcctcctcagcgccagaactcc
agggaagaaggggaccagcaggacagacggatacaaaggcggacatctttctacctcccc
aaagatgctgcgaagcacctgcacatcagctccgaaacacgagtgcgagaagtcatcgag
gcgttgctcaggaagttcactgtggtggacaacccagcaaagtttgccttgttcgagcgc
accgagaagcaaagccaagtctgcatgcgtaaaatgtctgaggacgagcgccctttgttt
ttgcgcctgtgcgctggccccagcgaaacagtgttgagtctggttttgaaagagaatgag
acaggggagataaattgggatgcttttagccttcctgagttgggcaactttctgcgaatc
ttgcagcgtgaggaagaagagcacgtgcggcagattgtaaggcgctacgctcacgctcgg
gacatgatgaagcaggccgtggctcgcataaccacacctggttga

DBGET integrated database retrieval system