KEGG   Kryptolebias marmoratus (mangrove rivulus): 108247740
Entry
108247740         CDS       T05608                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr01100  Metabolic pathways
kmr04020  Calcium signaling pathway
kmr04114  Oocyte meiosis
kmr04261  Adrenergic signaling in cardiomyocytes
kmr04270  Vascular smooth muscle contraction
kmr04371  Apelin signaling pathway
kmr04540  Gap junction
kmr04912  GnRH signaling pathway
kmr04914  Progesterone-mediated oocyte maturation
kmr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108247740 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108247740 (adcy3)
   04020 Calcium signaling pathway
    108247740 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108247740 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108247740 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108247740 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    108247740 (adcy3)
   04916 Melanogenesis
    108247740 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108247740 (adcy3)
   04270 Vascular smooth muscle contraction
    108247740 (adcy3)
Enzymes [BR:kmr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108247740 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 fn3_4
Other DBs
NCBI-GeneID: 108247740
NCBI-ProteinID: XP_017291584
UniProt: A0A3Q3B4G0
LinkDB
Position
Unknown
AA seq 1124 aa
MPRNRAFSEPEFSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYVLITCAVVYTSDRLASVVVASVGLTGDII
LYLLCRFGLLPDRITRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQQQQQDIQGAALARQLLANLVIYICAI
TVGVMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLKDMKK
EPSQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAK
YHQLRIKILGDCYYCICGLPVYREDHAASSIMMGLAMVEAISYVREKTQTNVDMRVGVHS
GTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGD
RCDYLRERGIETYLVVVPKGPVGKNGISGVKLSVTSSNGNSPLLINTTECNGSVNTACTT
PEEPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALK
GKHTNKLSLRFVDQDMETRFSVEKEKQSGAAFCCSCVVILFTAVMEALIDPRLIANYITF
AVGEVLLLILTICSMAAIFPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTMADLIDM
LSCLPGVPESGSPTEAPFSSSSSRHSLEGCLNNPKYYSYIAVLALMATTMLVQVSHMVKL
TLMLLITVTTGIVNIYSWREIFDRYDMVRFQNYSSSMVPSKFTMTFMIFVMMVSFYYFSR
HVEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQS
YDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIG
STYMAASGVTPDINNDYTCMKKEEQSDKERWQHLADLADFALAMKVTLMNINYQSFNNFM
LRIGLNKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFR
FVRRGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgccgcggaaccgagctttttcagaaccggagttttctgcggagtattcagcagactgc
tctgtgacgttgccctctgaccccggacaggctgtcgggcgaactcacgaggtgacggtg
agaagctctgggtgctgcctgtgcctgccgcgctttatgcgtctcacctttgcacccgag
tctttggagaacctctaccagacctacttcaggcggcagagacatgaaaccctgctggtc
ctggttgtgtttgcggccctgttcgacagctacgtcctcatcacgtgcgcggtggtctac
acctccgacaggctggcttctgttgtagtagcatcagttggactcacaggggatattatt
ctctacctgctgtgccgctttgggttgcttccggaccggatcacccggcgggtggtgccc
tacgccctctgggtgctcatagcagctcagattttctgctacttgggtctgaactatgct
cgctttcaccaggccagtgacacggtgggctggcaggcgtttttcagcttttctttcttt
ctcactctgcctttgagactcacacccattgtgctcatcaccactgtgtcctgtggggtc
cacaccctggttcttggggtcaccattgcacaacagcaacaacagcagcagcaggacatc
cagggggcagcactcgccaggcagctgttggccaacctagtgatctacatttgtgccatc
actgtgggtgtcatgtcgtactacatggctgaccggaagcatcggaaggcttttctggag
gcaagacagtcgttggaggttaaacttaacctggaagagcagagccagcaacaggagcgt
cttttgctctccattctacccaaacacatcgcagacgagatgctgaaggacatgaagaag
gagcccagtcagaaggagatgcagcagttcaacaccatgtacatgtacaggcatgaaaat
gtcagtattttgtttgcagacattgtgggcttcacccagctgtcctcatcctgcagcgct
caggaactggttaaactactcaatgaactatttgctcgctttgacaagttggctgctaaa
tatcaccagcttaggatcaagatcttgggagactgctactattgcatctgtggtcttccg
gtctacagggaggaccacgctgcttcttccatcatgatgggcctggccatggtggaagct
atttcgtatgttcgagaaaaaacccagaccaacgtggacatgagagtgggagtgcacagc
ggtacggtcctaggtggagttcttggccagaaacgatggcagtacgacgtctggtctaca
gatgtcactgtggccaacaaaatggaagctggcggtattcccggtcgggttcacatctcg
cagagtaccatggagtgtcttcatggagagtttgatgtggagccaggaaacggaggtgac
cgttgtgactacctgagggagaggggaatcgaaacctacctggtggttgttcccaaagga
cctgtggggaaaaacggcatcagtggtgtgaagctgtctgtaacctcttccaatggaaac
tctccccttttaatcaacacgacagagtgtaacggcagtgtgaacacagcctgcacgaca
ccggaggaaccagaggagctggacacaagggtggtaaatccatctttcccaaaccctcgg
aggaggctgcggctgcgggatctggctgaaagggtgatcgacgctcaggagaatgagcag
gagctcaacaagctgctgaacgaggctcttctggaaagagagacggttcaggctctgaag
gggaaacacaccaacaagctgtccctgaggtttgtagatcaagacatggagactcgtttt
tctgttgagaaggagaagcagagcggagctgccttctgttgctcctgtgtggttattctc
ttcactgccgttatggaagcactcatagatcccaggctgattgcaaactacatcactttt
gcagtgggagaggtgctgctgctcatcttgaccatctgctctatggcggccatctttccc
agagtttttcccaagaagctggtctctttctctacttggattgaccacactcggtgggct
cgaaacacctgggccatggcagccattttcatcctgactatggcagacctcatagatatg
ctaagttgtctgcctggagtcccagagtcaggcagtcccacagaggctcccttctcctcc
tcgtcctcccgtcacagccttgaaggttgcctgaacaaccccaaatattacagctacatc
gctgttctagcactcatggccaccacaatgctggttcaggtcagtcacatggtgaagctc
acactgatgctcctcatcacagtgacaactggcattgttaacatctacagttggagggag
atctttgaccgctacgacatggttcgcttccagaattacagttcatccatggttccttcc
aagttcacaatgacatttatgatcttcgttatgatggtcagcttctattacttctccaga
catgtggagaagcttgctcgaacccttttcctatggaagattgaggtccacgagcagaag
gaaaaagtgtatgagatgaggcgctggaatgaagctctggtgactaacatgttgcctgag
catgtggcgcgacactttctgggctctaagaaaagggatgaggagttgtacagccagtcc
tacgatgagattggagttatgtttgcctcaattcccaatttctctgatttttacactgaa
gagagcatcaataatggtggcattgaatgtttacgctttctcaacgaaatcatctcagac
tttgacagcctgctggacgagccacagttccgctgcatcacaaagatcaagaccatcggc
agcacctacatggcagcgtcaggtgtcaccccagatatcaacaacgactacacctgtatg
aagaaggaggaacagtctgacaaagagcgctggcagcacctggcagacctggcagatttt
gctcttgcgatgaaggtcacactcatgaacataaactaccagtcattcaacaacttcatg
ctacgcataggcctcaataaaggcggagtgttagcgggagtcattggtgcacgtaaacct
cactttgacatctggggcaacactgtgaacgtagcaagtcgcatggagtccacgggagtg
atgggaaacatccaggtggtggaggactgctacaacatcttgaaggagtacggtttccgc
tttgtgaggagggggcccatctttgtgaaggggaaaggggagctcctcacttattttctc
aaaggaagagacaagcaaggctcatttatcaacggctcctcggtcactctgccacaccag
gtggtggatagttaa

DBGET integrated database retrieval system