KEGG   Kryptolebias marmoratus (mangrove rivulus): 108247801
Entry
108247801         CDS       T05608                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04060  Cytokine-cytokine receptor interaction
kmr04068  FoxO signaling pathway
kmr04144  Endocytosis
kmr04218  Cellular senescence
kmr04350  TGF-beta signaling pathway
kmr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108247801
   04350 TGF-beta signaling pathway
    108247801
   04068 FoxO signaling pathway
    108247801
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108247801
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108247801
  09143 Cell growth and death
   04218 Cellular senescence
    108247801
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108247801
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108247801
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108247801
Protein kinases [BR:kmr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108247801
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Choline_kinase
Other DBs
NCBI-GeneID: 108247801
NCBI-ProteinID: XP_017291655
UniProt: A0A3Q3GUH1
LinkDB
Position
Unknown
AA seq 557 aa
MMARCWALWTGIIVLLTACPPGAVQSFSHLRYNLCKWCEVSSPVCKDSICLSKCNLSSFC
TGIEEICIAIWRKTNNTMTVHTMCHHPTLPLDGVDPTLLLNFTSRECHMIPQMVEDGAMM
VCGCQGEHECNDKLIFDKGANGFSRVQSKDVIPVVVISLVPPVLVAIVATVAFYFYRIRC
PDKPGHPARPDWPTKRSPELYQALDIPHEAAGCRTEGGGGGVIGPGVEQEGQVAELLPVK
LDMLVGKGRFAEVWRARLLQGQKGGVDSYETVAVKVFPAMEYTSWRNECSIFSETTLQHD
NIIQFLAAEERGPPGETYWLVLAYYSLGNLQDYLTANILSWEELVSMGGSIAKGLAHLHC
DTTCNGEPKVPVAHRDLKCSNILVKNKKQCALCDFGLALRLDLSLTVDDYAHSGQVGTAR
YMAPEVLESRVNLEDLEAFKQMDVYSTALVLWEMTSRCAAIGEVKSYEPVFGSKVCEQPC
VDSMRDLVLRDRGRPDIPSTWMQHQGMSVVCSTITECWDHDPEARLTAHCVVERFTALQQ
GEEGEEAEDEEDRVRQV
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgatggctcggtgctgggctctttggaccgggatcatcgtcctcctcacagcctgtcct
ccaggtgctgtccaatctttcagccacctgagatacaacctgtgtaagtggtgtgaggtg
tccagtccagtgtgcaaagacagcatttgtctcagtaaatgcaacctgtcctccttctgc
actggcatcgaggagatctgcattgccatatggaggaagaccaacaacacaatgacagtg
cacacaatgtgtcaccacccaactctgcctctagacggtgttgaccccaccctactgctg
aacttcacctccagggaatgtcacatgatcccacagatggtcgaggatggagccatgatg
gtctgtggctgccagggtgaacatgaatgcaatgacaaactcatctttgacaaaggagcc
aatggtttctctagggtgcagagtaaagatgtcatcccagtggtggtgatcagtttggtg
cctcctgtcctggtggccatagttgctactgttgccttttacttttacagaatacgctgc
cctgataaaccaggccatcctgcacgtccagactggcctactaaacgttccccagagctc
taccaagctttggacataccacatgaggcagcaggttgtaggactgaaggtggaggagga
ggtgtgattggtcctggagttgaacaggagggccaggtggctgaactactgccagtcaaa
ctggatatgttggtggggaaagggcgctttgctgaagtgtggagggcacgcctgctacag
ggccagaagggtggagttgacagttatgaaactgtagccgtaaaggtgtttccagccatg
gagtacacctcatggagaaatgagtgctccatcttctctgaaactacattgcaacatgac
aacataattcagtttctggcagctgaagaaagaggcccaccaggggagacctattggctt
gtgttggcctattacagtctggggaatctgcaagactacctcacagcaaatatactgagc
tgggaggagctagtttccatgggaggaagcatagcaaaaggactggctcacctccattgt
gacacaacatgcaatggggaaccaaaggtaccagttgcccacagagacctaaagtgcagc
aatattttggtaaagaacaagaagcagtgtgccctgtgcgactttggtctggccttaagg
ttagacctctcactcacggttgatgactacgcacacagtggacaggtgggaacggctcgc
tacatggctcctgaggtactggagtccagggtgaacctggaggaccttgaggcctttaag
cagatggatgtttattccacggctctggttctgtgggagatgacctcccgctgtgcggcc
attggggaggtgaagagctatgagccggtgtttggctcaaaggtttgcgagcagccctgc
gtggacagcatgagagacctggtgctgagggaccgaggacgaccggacatcccctcaacg
tggatgcagcaccaggggatgagcgtcgtctgttccaccatcacggagtgctgggatcat
gacccggaggccaggctgaccgctcattgtgtggtggagcgcttcactgccttgcagcag
ggtgaggagggggaggaggcagaagatgaggaggacagagtgaggcaggtgtaa

DBGET integrated database retrieval system