KEGG   Kryptolebias marmoratus (mangrove rivulus): 108248382Help
Entry
108248382         CDS       T05608                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00512  Mucin type O-glycan biosynthesis
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108248382 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmr01003]
    108248382 (galnt17)
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108248382 (galnt17)
Glycosyltransferases [BR:kmr01003]
 O-Glycan biosynthesis
  Mucin-type
   108248382 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 108248382
NCBI-ProteinID: XP_017292629
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MAFVFRRWRVLLLLNVLAVAGFMTFWAKCNSRSVQSAGPEAPAAGRGPRANGTAQQQGPG
ISHEVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPLEENDAKYLREK
YGYNAYLSDRISLDRTIPDHRPSKCRKVNYSRDLPQISLIFIFVNEALSVILRSVHSAVN
HTPAHLLKEIILVDDNSDDELLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKVA
TAEVTGFFDAHVEFTPSWAEPVLARIKDDHKRIILPSIDNIKHDTFEVERYENSGHGYNW
ELWCMYINPPKQWWDEGDMSAPIRTPAMIGCSFVANRDYFGELGLLDSGMDVYGGENIEL
GIRVWLCGGSMEVLPCSRVAHIARIKKPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAW
NIPMENHGIDYGDVSQRVALRKSLQCKSFQWYLDNVYPEMRRYNNTLYYGEIRNNKVSHL
CVDQGMKENHTATLHPCHGWGPQLGRFTKEGQLFLGPLGSTGEDTRCVVDDQISSFPQLL
NCDKVSNMKQKTWSFSQNDAITNRATGRCLEVVPANVYFGHLLVLQPCSGQRWTIKNTMK
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtcttcagaagatggagggtcttactgctgctcaacgtgctcgcggtagcc
gggttcatgaccttctgggccaaatgcaacagccgcagcgtccagagcgccggtccggag
gctcccgctgccgggagggggccccgggccaacgggacagcgcagcagcaggggcccggc
atcagccacgaggtgctgctgaagaggctcagctcgctggaggatgtggtgtacaggcag
ctgaacggtctgtccaaatccctgggtctgattgaaggctttggcggtcgtggtaaaggc
ggcctccctgccacgctttcacctctggaggagaatgatgcaaaatacctgagggagaag
tacggctacaacgcctacctgagtgaccggatctctctggaccggaccataccggaccac
cggcccagcaaatgcagaaaggtcaactactccagagacctcccccaaatctcgctcatc
ttcatcttcgtgaacgaggctctgtcggtgatcctgcgctcggtccactcggctgtcaat
cacaccccggctcacctgctcaaagagatcatcctggtggatgacaacagtgacgacgag
ctgctgaagggaccgctggaggaatacgtcaacaagcggtacccgggcctggtgaagatc
gtaaggaaccagaaacgggaggggctgatccgggccagaatcgagggctggaaggtggcc
accgctgaagtgacgggattttttgatgctcatgtggagtttaccccttcatgggccgag
cctgttcttgccagaatcaaagacgaccacaaaagaatcatcctgccgtccatcgacaac
atcaaacacgacacgttcgaggtggagcgctacgagaactcgggccacggctacaactgg
gagctgtggtgcatgtacatcaacccgcccaagcagtggtgggacgagggagacatgtct
gctcctataaggacgcctgccatgattggctgctccttcgtggccaatcgggactacttc
ggagagctcgggctgctggactcgggcatggacgtctacggaggcgagaacatcgagctg
ggcatcagggtgtggttgtgtggggggagcatggaggtgctgccctgttccagagtggct
cacattgctcggataaagaaaccttaccacagcaacatagcgtttcacacacggcgtaac
gccctgcgcgtggctgaggtctggatggatgagtacaagtccaacgtgtacctggcctgg
aacatccccatggagaaccacggcattgattacggagacgtgtctcagagggttgcactg
aggaagagtctgcagtgcaagagctttcagtggtaccttgacaacgtgtacccggagatg
aggcggtacaataacacgctgtactacggcgagatccgcaacaacaaagtgagccacctg
tgtgtggatcagggcatgaaggagaaccacacggccaccctgcacccctgccacggctgg
gggcctcagctgggacgcttcacgaaggagggccagctgttcctgggtcccctggggagc
accggcgaggacactcgctgcgtggtggacgatcagatcagcagcttcccgcagctcctg
aactgtgacaaggtgtccaacatgaagcagaagacatggagcttctctcagaacgatgcg
atcacaaaccgagccacgggccggtgtctggaggtggtgccggccaacgtttacttcggt
cacctgctggtcctgcagccctgctcgggtcagaggtggaccatcaagaacaccatgaag
caataa

DBGET integrated database retrieval system