KEGG   Kryptolebias marmoratus (mangrove rivulus): 108249185
Entry
108249185         CDS       T05608                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04210  Apoptosis
kmr04620  Toll-like receptor signaling pathway
kmr04621  NOD-like receptor signaling pathway
kmr04622  RIG-I-like receptor signaling pathway
kmr04623  Cytosolic DNA-sensing pathway
kmr04625  C-type lectin receptor signaling pathway
kmr04920  Adipocytokine signaling pathway
kmr05132  Salmonella infection
kmr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108249185 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108249185 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108249185 (ikbkg)
   04621 NOD-like receptor signaling pathway
    108249185 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    108249185 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    108249185 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    108249185 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108249185 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108249185 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108249185 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108249185 (ikbkg)
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108249185 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 APC_N_CC
Other DBs
NCBI-GeneID: 108249185
NCBI-ProteinID: XP_017293882
UniProt: A0A3Q2ZUC2
LinkDB
Position
Unknown
AA seq 593 aa
MVQPQPDGPLQWDMSGEDSGGTLRVPPELAGNEVVTKLLCNNQQLREALRRSNLALRQRC
EEMEGWQRKTREEREFLSCRFQEARALVERLAQENHSLQSMVNLPASSSNHCCNSSQTED
SQGRPAKNGPVDGPQTLDQWERKRVEDTEQQTQTTPLRSLPVEGANEFLQLLKSHKEEMK
EGTRELRRKNEELERKTEELEKKMEEGEEEKDRMRRCIEQLRTKLLQAQASGGSEEAVPL
RSEAQHSSDCFGLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQ
LAKDCEALKAQATSLLGELNESQSCLKKSEYERTVLEEKVIGKAKALQAAERELEQQKTQ
HNVAMDKLLLQVQGLEQALKTERHTVTEEKKKLTQLQHAYTCLFRDYDSKLKNEEGDLSS
RLEEAERALALKQDHIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQK
KEELQEQLNQAMVEIEALKQEALSRERIEKMKLRHSNDFRQRAVYYPPPPVPPGAAFHTV
PALPSLRNPGLLPVVNLGPGEPEEPLPDLCCPKCHYLAPDMDTLQIHVMDCIQ
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggtgcagccacagcctgatggtcctctgcagtgggacatgtcaggggaggacagcgga
gggaccctcagggtcccaccggagctcgccggcaatgaagtggtgaccaagctgctgtgc
aacaaccagcagctcagagaggctctgcggcggagcaacctcgccctgcgtcagcgctgc
gaggagatggagggctggcagcgaaaaaccagggaggagcgggaatttctcagctgtcgc
ttccaggaggccagggcgctggtggagaggctggcccaggagaaccactccttacagagc
atggtgaacttaccggcctcgtcctccaaccactgctgcaattccagccagaccgaggac
tcgcagggacgcccggccaaaaacgggccggtggacgggccacagactctggatcagtgg
gagaggaaaagagttgaagacactgagcaacaaacccaaaccacgccgcttcgcagcctg
ccggtggagggcgccaacgagttcctgcagctgctgaagagccacaaagaggagatgaag
gagggaacgagggaactcaggaggaaaaacgaggagctggagaggaagaccgaagagctg
gagaagaagatggaggagggagaggaagagaaagatcgaatgcgtcgttgcatcgagcag
cttcgaaccaagctgctccaggcgcaggcaagcggcggctctgaagaggcagttccgctc
cgctctgaggcgcagcattcctccgactgttttggcctggctaaactcacagagcagctt
caggccacacagggcaggtatcgggagttggaggagaagctggattacctgcagaagagc
tcagctcagcgcgacaggacggaagctctgctcaaacagaaggacaaggactgcgctcag
cttgccaaagactgcgaggcgctgaaagctcaggcgacttccctgttaggagaactgaac
gagagtcagagctgcctgaagaagagcgagtacgagcgcaccgtactggaggagaaggtg
atcggtaaggcgaaggcgctgcaggctgcagagcgggagctggagcagcagaagacgcag
cataacgtggccatggacaagctgctgctgcaggtccagggcctggagcaggccctgaag
accgagaggcacaccgtcacagaggagaagaaaaagctgacacagctgcagcatgcctac
acgtgtctgttcagagactacgactccaaactgaagaatgaggaaggagacctgagcagc
cgcctggaggaggcagagcgagcgctcgccctgaagcaggaccacatcgacaaactgaag
gaggaggtggagcaacagaagggctcgctggagaccgtccccgtcctgaccgcgcaggct
gagatctacaaggcagacttcctcgcagagcgagaagcaagagagaagctgaaccagaag
aaagaggagctgcaggagcagctcaatcaggccatggtggagatcgaagcgctcaaacag
gaggccttatcacgcgaacgcatcgagaaaatgaagttgagacactcgaacgacttccgc
cagcgagccgtttattaccccccgccgccagtgccccctggagcagccttccacacggtc
ccggctctcccgtctctccggaaccctggtttgttaccggtcgtcaatctgggaccaggg
gaacccgaggagccgctgcctgatttatgttgcccaaagtgtcattacttggctccggac
atggacacgctgcagatacacgtcatggactgtatacagtaa

DBGET integrated database retrieval system