KEGG   Kryptolebias marmoratus (mangrove rivulus): 108249480Help
Entry
108249480         CDS       T05608                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00010  Glycolysis / Gluconeogenesis
kmr00053  Ascorbate and aldarate metabolism
kmr00071  Fatty acid degradation
kmr00280  Valine, leucine and isoleucine degradation
kmr00310  Lysine degradation
kmr00330  Arginine and proline metabolism
kmr00340  Histidine metabolism
kmr00380  Tryptophan metabolism
kmr00410  beta-Alanine metabolism
kmr00561  Glycerolipid metabolism
kmr00620  Pyruvate metabolism
kmr01100  Metabolic pathways
Module
kmr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108249480 (aldh2)
   00053 Ascorbate and aldarate metabolism
    108249480 (aldh2)
   00620 Pyruvate metabolism
    108249480 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108249480 (aldh2)
   00561 Glycerolipid metabolism
    108249480 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108249480 (aldh2)
   00310 Lysine degradation
    108249480 (aldh2)
   00330 Arginine and proline metabolism
    108249480 (aldh2)
   00340 Histidine metabolism
    108249480 (aldh2)
   00380 Tryptophan metabolism
    108249480 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108249480 (aldh2)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108249480 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108249480
NCBI-ProteinID: XP_017294377
UniProt: A0A3Q3AVE4
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRTVFSRAFSPRLIRQSVSSYGTAIPAPSLQPEVHYKKLFINNEWQDAVSGKTFPTINP
TTGEVICQVAEADVADVDKAVKAARDAFRLGSPWRRMDASHRGLLLNKLADAIERDSAYL
AELETLDNGKPYAIAFSVDVPMVVKCLRYYAGWADKCEGKTIPVDGDYFSYTRHEPVGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILS
GFGPTAGAAIAKHMDVDKVAFTGSTDVGHLIQQASGSSNLKKVTLELGGKSPNIILSDAN
MEDAVEQSHFALFFNQGQCCCAGSRTYVHSDIYDEFVERSVERAKRRVVGNPFDLKTEQG
PQVDQEQFNKILGYITTGKREGAKLMCGGGVAADKGYFIQPTVFGDVQDNMTIAREEIFG
PVMQILKFTSLEEVITRANDTKYGLAAAVFTKDIDKANYVSNGLRAGTVWINCYDVFSAQ
APFGGYKASGNGRELGEYGLDIYTEVKTVTMKVLQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtacagtcttttctcgggcgttttctccacgattgatccgacagtccgtgtct
tcctatggaacagccatcccagcgccgagcctgcagcccgaggtccattataaaaagctg
tttataaacaatgagtggcaggatgcagtaagtgggaaaactttccctaccatcaatcca
acaaccggagaggtcatctgtcaagttgcagaggctgatgtggcagacgtagacaaggca
gtgaaggcagcacgggatgccttcaggctgggctctccatggcgccggatggatgcctct
catcgtggcctgctgctcaacaagttagctgatgctattgagagggattcagcatacctt
gctgaactggagactctggataatgggaagccatatgctattgcgttttctgtggatgtt
cccatggtggttaaatgtctcaggtactatgcaggttgggctgacaagtgtgagggtaag
accatccctgttgatggagactacttcagctacaccagacatgaacctgttggagtctgt
ggacagataataccgtggaacttccccctcttgatgcaggcctggaaactgggtccagcc
ctggcgactggtaatactgtagtaatgaaagttgcagagcagacacctcttacagcgctt
tacgtggccagtcttatcaaagaggtcggttttcctgaaggtgttgtgaatatcttgtct
ggatttgggccaacagctggtgctgccattgcaaagcatatggatgtggacaaggtggcc
tttactggatccacagatgtgggccatctaatccagcaggcctctggcagcagtaacctg
aagaaagtcacattggagctgggagggaagagtcctaatatcattctctctgatgccaac
atggaagatgctgtggagcagtcccactttgccctgtttttcaaccagggtcagtgctgc
tgtgctggctctcgaacatacgttcactcagacatctacgatgagtttgttgagcgcagt
gtagagcgtgctaagagaagagtggtgggaaacccatttgacttgaagactgagcagggc
cctcaggtggatcaagagcagttcaacaaaattctgggctacatcaccactggaaagaga
gaaggtgccaagctgatgtgtggaggaggagtggctgcagataaaggatacttcattcag
cctactgtttttggagatgtccaggacaacatgaccattgccagggaagagatctttggt
ccagtgatgcagatcttaaagtttacatccctggaggaagtaataacaagagctaatgat
actaaatatggactagcagctgctgtttttacaaaggacattgataaagccaactatgtg
tccaatgggctccgtgctggcacagtttggataaactgctatgatgtgttttcggctcag
gctcccttcggggggtacaaggcttcagggaatggcagagagctgggagagtatggcctt
gacatctacacagaagttaaaacggtgaccatgaaggtgctgcagaagaactcctag

DBGET integrated database retrieval system