KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250238
Entry
108250238         CDS       T05608                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108250238 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108250238 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108250238 (kitlg)
Cytokines and growth factors [BR:kmr04052]
 Growth factors
  Growth factors (RTK binding)
   108250238 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 108250238
NCBI-ProteinID: XP_017295507
LinkDB
Position
Unknown
AA seq 303 aa
MKKSKSWIHVCVRFLLFITLWVHLATLEATDVTDDTKIILPALKQNIPKDYKIPVDYIPK
EVAGMCWVKLNIYNLEKSLQDLADKFGNISSNKDNINLVIQYLHDVRIKIRNELELEMYE
FQCHSRRERWETERYFDFVKNLYGAAHHQDFSYECDPPPCPSTPPTAKDATIKRCDWQEM
EQSVQIFPSKVVPPWTPLPRCRPLPQSHLPAAVKALYKQPKAQGTLQGGDVFDTMKLILP
SLMFVPLLALILLLVWKVKSRRNRQDHPQNPGEEELFTETEGGASPLKAETPETIILNVI
ETV
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtctgtgtccgtttcctgctgttcatcacactt
tgggtacatttagccacacttgaagctaccgacgtgactgatgacactaaaataatcctt
cctgctttgaaacaaaatattccaaaagattacaaaattcctgtagattacattccaaaa
gaagtggctgggatgtgttgggtgaaattaaatatatacaacttggagaagagtttacaa
gatttagctgataagtttgggaatatttcatcaaataaagataacattaatttagtcatc
caatatcttcatgatgtgcgaataaaaatcaggaatgagttagaactggaaatgtacgag
tttcagtgccacagcagaagagagaggtgggaaacagagagatactttgattttgtcaaa
aatctctacggagctgcacatcatcaagacttttcatatgagtgtgatcctcctccctgt
cccagtacaccaccaacagccaaagacgcaacaataaaaagatgcgattggcaagagatg
gagcaatctgtacagatcttcccgagcaaagtcgttcctccctggacacccctccctcgg
tgtcgcccgctccctcagagccacctgccagcagcagtcaaagctctttacaaacaacca
aaagctcaaggtacactacaaggaggagatgtttttgacacgatgaagctgatccttccc
tccttaatgtttgttcccctccttgctctcatccttctgctggtgtggaaggtaaaatca
agaaggaacagacaggatcatccacagaatcctggagaagaagagctctttacagaaaca
gaagggggggcatctccgctaaaagctgaaacaccagaaacaattatactgaacgtcatt
gaaactgtgtaa

DBGET integrated database retrieval system