KEGG   Kryptolebias marmoratus (mangrove rivulus): 108251075Help
Entry
108251075         CDS       T05608                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108251075 (gpd2)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     108251075 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 EF-hand_6 FAD_oxidored GIDA EF-hand_8 Pyr_redox_2 Pyr_redox_3 EF-hand_4 HI0933_like EF-hand_5 Thi4 NAD_binding_8 EF-hand_9 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 108251075
NCBI-ProteinID: XP_017296734
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MAFRKVLRRTAAVGGGAVAAAFGLSQLMEYRRRQPGSARLAHVAAEAELKVPYADELPPR
HAQLAALRDAEEFDVLVIGGGATGAGCALDAVTRNLKTALVERSDFSSGTSSRSTKLIHG
GVRYLQKAVMQLDYEQYLMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGI
KMYDLVAGIHCLKSSYVLSKSRALELFPMLKKDRLVGAIVYYDGQHNDARMNLAIALSAA
RHGAAVANYTEVVRLLKTEEQKVCGARCRDVITGQEFDVKAKCVINATGPFTDSLRKMDE
QEVPNICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWENMTVAGTTDTPTDVT
AHPIPGEDDINFILREVRNYLSADVEVRRGDVLAAWSGIRPLVTDPNSRDTQSICRNHVV
SISNSGLVTIAGGKWTTYRSMAEETLDAAIKGLSLAAEPCRTVGLMLEGAKGWTPTLYIR
LVQDYGLEKEVAQHLASTYGGKAFDVAKMAQVTGQRWPIVGKRLVSEFPYIEAEVLYAVK
EYACTAIDVIARRTRLGFLNVQAADEALPRIVQIMGKELSWSQEKKTEEMEAARKFLYHE
MGYRSRSEQLTKTSEINLDYQEIVRYKNRFHKFDKETKGFITTVDVQRVLESINVHIDEN
ALHEILNEVDLNKNGQVEIDEFLQLMSAVKKGQVSDSRLAILMKTAEETLDKRGPVTVDR
SGGGV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaggaaagtcctgaggcggacggcggccgtcggaggcggagccgttgccgcg
gcgttcgggctgtcgcagctgatggagtaccggaggaggcagcctggatcggcgcggcta
gctcacgtcgcagccgaagccgagctgaaggtcccgtacgcagacgagctgccgccacgc
cacgcccagctggcggcgctgcgggacgccgaggagttcgacgtcctggtcatcggaggc
ggggccacgggggccggatgtgccttggacgccgtcacgcgcaatctgaaaacggccctc
gtggagcgaagcgacttctcttcgggcaccagcagccgaagcaccaagctgatccacggc
ggcgtgcggtacctccagaaggccgtcatgcagctggactacgaacagtacctgatggtg
aaggaggctctgcacgagcgagccaacctgctggagatcgctcctcacctgtcggcgccg
ttacccatcatgcttcctgtctacaaatggtggcagctgccgtactactgggcggggatc
aagatgtacgacctggtggccgggatccactgcctgaagagcagctacgtcctcagcaag
tccagggcgctggagctgttccccatgctgaagaaggacaggctggtgggcgccatcgtc
tactacgacggtcagcacaacgacgcccgaatgaaccttgccatcgctctctccgccgct
cgccacggcgccgccgtcgccaactacaccgaggtggttcggctgctgaagaccgaagag
cagaaggtgtgcggagcgcgctgccgtgacgtcatcacagggcaggagttcgacgtgaag
gcgaagtgcgtgattaacgccaccgggccgttcacggactcactgaggaagatggacgag
caggaagtcccgaacatctgccagcccagcgccggcgtccacatcgtcatcccgggttac
tacagtccggacaacatgggcctcctggacccggccacgagcgacggccgggtcatcttc
ttcctgccctgggagaacatgacggtcgccggcaccaccgacacgcccaccgacgtgacg
gcgcaccccatccccggggaggatgacatcaacttcatcctgagggaggtgcgcaactat
ctgagcgccgacgtggaagtccgcaggggggacgtcctggcggcgtggagcggcatccgc
cccctggtgacggaccccaactccagagacacccagtccatctgcaggaaccacgtggtc
agcatcagcaacagcgggctggtcaccatcgcaggtgggaagtggaccacctacaggtcc
atggccgaggagactctggacgcagccatcaaaggcctcagcctcgcagccgaaccctgc
aggacggtgggtctgatgctggagggagcgaagggctggacgccgacgctctacatccgc
ctggtgcaggactacggcctggagaaggaggtcgcccagcacctggcctccacctacgga
gggaaggcgttcgacgtggccaaaatggctcaggtgacgggacagaggtggccgatcgtc
gggaagaggctggtgtctgagttcccctacatcgaggctgaggtcctctacgccgtcaag
gagtacgcctgcaccgccatcgacgtcattgctcggcggacgcgcctgggcttcctgaac
gtccaggcggcggacgaagcgctcccacgcatcgttcagatcatgggcaaagagctgagc
tggagtcaggagaagaagacggaggagatggaagcagccaggaagtttctgtaccacgag
atgggctacaggtcgcgctccgagcagctcacaaagacctccgagatcaacctggactac
caggaaatcgtcaggtacaagaatcgattccataagttcgacaaggagaccaaaggcttc
atcaccaccgtggacgtccagagagttctggagagcatcaacgtccacatcgatgaaaac
gccctgcatgaaatcctcaatgaggtggacctgaacaagaacgggcaggtggaaatcgac
gagttcctgcagctgatgagcgccgtgaagaagggacaagtgtccgacagccgcctggcc
atcctcatgaagaccgccgaggagacgctggacaaacgagggccggtgacggtggaccgg
agcgggggcggagtctga

DBGET integrated database retrieval system