KEGG   Kryptolebias marmoratus (mangrove rivulus): 108251274Help
Entry
108251274         CDS       T05608                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6 isoform X1
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108251274 (mapk6)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108251274 (mapk6)
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108251274 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 108251274
NCBI-ProteinID: XP_017297004
LinkDB All DBs
Position
Unknown
AA seq 758 aa AA seqDB search
MAEKFESLMNIHGFDLGARYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPCGRSLTEDVASLTEVNSVYIVQEYMETDLCQLLE
RGPMSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFSEMLTGKTLFAGAHELEQ
MQLILESIPVLRDEDRQELHSVIPVFIRNDMSKPHTPLPQLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSHSHTWDSRYHESQ
FSEADWNLHSTHDPDEVQVDPRALSDVTDEEEVQVDPRKYADGDREKFLDEPSFDYSTRH
PPERSWQDEHHENKYCDVQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWK
EQQSKEKADRKAKSKCEKNGLVKAQMALQEAEKSQGLVEKDSVQEKHQTERPPSQQNQGF
DFDSFIASTIKLSLQPEPGPEVTLLSEVGLLNELNFSVSQLEAPRSSSVSKTISQEKEEK
CLVNLAQLGGGGLGVVAGDCVWPAKPWENFSSGERVGETSCLIDEACWDIGNVDHFQKES
TYTSYLDRLFSRKEEGVAEGVASSEMESSVVKELDDSFLDSSAEIVLNMQLDSLALPGFD
SPDDLPLKSIQASLTPCAVKCSPQIAHKTYSSIFKHLN
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgagtccctgatgaatatccacggcttcgacctgggggcccgctac
atggacctgaagcccctgggctacggcgggaacggcctggtgttctcggcagtcgacacc
gactgtgacaagcgcgtggctgtgaagaagatcatcttgaccgaccctcaaagcgtgaaa
cacgccttacgggagatcaagattatccgacgactcgaccacgacaacatcgtgaaggtg
tttgagaccctgggtccctgcggtcgcagtctaacggaggacgtggcgtctctgacggag
gtgaactcggtctacatcgtacaggagtacatggagacggatctctgtcagctgctggag
aggggcccgatgtctgagggccacgccaggctcttcatgtaccagctcctcaggggcctg
aagtacatccactcagccaacgtgctgcatcgtgacctgaagcccgccaacctgtttgtc
aacacggaggacctggtgctgaagatcggggacttcggcttggcccgcatcatggatcct
cactactcccacaagggccacctctctgaaggcctcgtcacaaagtggtacagatctcct
cgcctgctgctctcgcccaacaactacaccaaagctatcgacatgtgggccgccggctgc
atcttctctgagatgctcactgggaaaactctcttcgcaggagcgcacgagctggagcag
atgcagctgatcctggagtccatccccgtcctgcgagacgaagaccggcaggagctccac
agcgtcatccccgtcttcatccgcaacgacatgtcgaagcctcacacgccgctgccccag
ctgctgcccgacgtcagcccgcaggccctggattttctggagaagatcctgacctttaac
cccatggatcgcctgactgcagaggaggccctggcccacccctatatggccgactactcc
ttccccctggacgagcccgtctctctgcacccctttcacatcgaggacgaagtagacgac
atcctgctcatggaccagagccacagccacacctgggacagcagatatcacgagagccag
ttctcagaggctgattggaacttgcacagcacccatgacccagatgaagtccaggttgac
cccagggctctgtctgacgtcacggatgaagaggaggtccaggtggatccacggaaatac
gccgacggagatcgggagaagttcctggatgagccgtccttcgactactcgacccggcac
ccgccggagcgatcgtggcaggacgagcaccacgagaacaagtactgtgacgttcagtgt
agccacacctgcaactacaaggccgtgtctccgtcctacctggacaacctgatctggagg
gacagtgaagtcaaccactactacgagcccaagctcatcatcgacctctccaactggaag
gagcagcagagcaaggagaaggccgaccgcaaggccaagtccaagtgtgagaagaacggg
ctggtcaaggcccagatggctctgcaggaggccgagaagagccagggcctcgtggagaag
gacagcgtccaggagaaacaccaaacagaacggcctcccagccagcagaaccaaggcttt
gactttgactctttcatcgccagcaccatcaaactgagcctgcagccagaaccgggcccg
gaggtgaccctgctcagcgaggtgggcctcctgaacgagctcaacttttctgtctcccag
ctggaggcgccacgctccagctccgtgtcaaagaccatcagtcaggagaaggaagagaag
tgcctggtcaacctcgcccagttaggcggggggggcttgggggtcgtcgccggggactgc
gtctggcccgccaaaccctgggagaacttcagctccggggaaagagtcggggagaccagc
tgcttgatagacgaagcgtgctgggacattgggaacgtggaccacttccagaaggagagc
acctacaccagctacctggaccgcctgttcagccggaaggaagagggcgtggcggagggc
gtggccagctcggagatggagtcctcggtggtgaaagagctggacgacagcttcctggac
agtagcgccgagatcgttcttaatatgcagctggactctctggccctgcccggctttgac
agccccgatgacttgcctctgaaatccatccaggcctcgctcacaccctgcgctgtcaaa
tgttctccacagatcgcccacaaaacctacagcagcatcttcaagcatctgaattaa

DBGET integrated database retrieval system