KEGG   Kryptolebias marmoratus (mangrove rivulus): 112450491
Entry
112450491         CDS       T05608                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04012  ErbB signaling pathway
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
kmr04115  p53 signaling pathway
kmr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112450491
   04068 FoxO signaling pathway
    112450491
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112450491
   04115 p53 signaling pathway
    112450491
   04218 Cellular senescence
    112450491
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112450491
NCBI-ProteinID: XP_024861598
LinkDB
Position
Unknown
AA seq 159 aa
MGNQIKFAEQCGVMAAARGRILRRPGSARRNLFGPVDREQLQEEYRAALRRDLEEASERW
GFDFTAGRPRQGGRFQWERVPDARVPPLYRSWGQRAAGPGRLEPAESDKENTPGTPGLED
MERTPERGEDTGLKRKQTNITDFYQAKRRVVWLPRKSGE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaccaaattaagttcgctgaacagtgcggagtgatggctgcagctcgcgggcgg
atcctgaggagacccgggtctgcccggcggaacctgttcggccccgtggaccgggagcag
ctccaggaggagtaccgcgccgcgctgcgcagagacctggaggaggcgtccgaacgctgg
ggcttcgacttcaccgccggcaggccccggcagggcggccgcttccagtgggagcgcgtg
ccggacgcccgcgtgccgccgctctacaggtcctggggtcaaagggcagcgggcccggga
cggctggagccggcggagagcgacaaggagaacaccccggggaccccgggactggaagac
atggagaggacgccggagaggggagaggacacgggcctgaagaggaaacagacgaacatc
acagatttctaccaggctaagaggagagtcgtttggctgccgcggaagtccggcgagtga

DBGET integrated database retrieval system