KEGG   Kluyveromyces marxianus: KLMA_10341Help
Entry
KLMA_10341        CDS       T05269                                 

Gene name
PFK1
Definition
(RefSeq) 6-phosphofructokinase subunit alpha
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00010  Glycolysis / Gluconeogenesis
kmx00030  Pentose phosphate pathway
kmx00051  Fructose and mannose metabolism
kmx00052  Galactose metabolism
kmx00680  Methane metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
kmx01230  Biosynthesis of amino acids
kmx03018  RNA degradation
Module
kmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLMA_10341 (PFK1)
   00030 Pentose phosphate pathway
    KLMA_10341 (PFK1)
   00051 Fructose and mannose metabolism
    KLMA_10341 (PFK1)
   00052 Galactose metabolism
    KLMA_10341 (PFK1)
  09102 Energy metabolism
   00680 Methane metabolism
    KLMA_10341 (PFK1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    KLMA_10341 (PFK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kmx01009]
    KLMA_10341 (PFK1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kmx03019]
    KLMA_10341 (PFK1)
Enzymes [BR:kmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KLMA_10341 (PFK1)
Protein phosphatases and associated proteins [BR:kmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KLMA_10341 (PFK1)
Messenger RNA biogenesis [BR:kmx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KLMA_10341 (PFK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Pfk_N DAGK_cat
Motif
Other DBs
NCBI-GeneID: 34714008
NCBI-ProteinID: XP_022673863
LinkDB All DBs
Position
1:688044..690980
Genome map
AA seq 978 aa AA seqDB search
MSVSNTIYGVAFRSLSTSDEQLYRKTARFYHSLGFQTVKLYDNFKNHDDSHLIVGTSKNS
VKECWLESFKLSQVDAEGFRVPQQEASNQDQSDGVMIKLRMVESEPAVQKADVIVYYTVS
LEEVAKFGESLDAHTVKLVDPLGNTILVTDEVSGKKLNAAEFIEPKDTSDEHKITIDLGD
KDQKKKKIAVMTSGGDSQGMNAAVRAVVRTGIYYGCDVYAVYEGYEGLVKGGDLLKKMEW
QDVRGWLSEGGTLIGTARSKEFRERWGRKQAAANLIEQGIDALVVVGGDGSLTGADLFRS
EWPSLVDELVKEGKFTKEQVAPYHNLTIVGMVGSIDNDMSGTDSTIGAYSALERICEMVD
YIDATAKSHSRAFVVEVMGRHCGWLGLMSGIATAADYIFIPERAAPHGKWQDELKRVCQR
HREKGRRNNTVIVAEGAVDDQLNPITAEQIKDVLVELGLDTKITTLGHVQRGGTAVAHDR
WLATMQGADAVKAILEMTPETPSPLIGILENKVIRMPLVESVKLTKEVATAIEAKDFDKA
ISLRDTEFIELYDNFISTTVNDDGSQLLPEGERLNIAIVHVGAPSAALNAATRAATLYCL
AHGHKPYAIMNGFSGLIQTGQVKELSWIDVEDWHNLGGSEIGTNRSVAAEDMGTIAYYFQ
KHKFDGIIIMGGFEGFKSLKQLRDGREEYPIFNIPMCLIPATVSNNVPGTEYSLGADTCL
NALVKYTDAIKQSAAASRRRVFVVEVQGGHSGYVASFTGLVTGAVSVYTPEKKIDLQSIK
EDLALLKESFRNDQGETRNGKILIRNEMASTVYTTELLADLITEQSNNRFAVKTAIPGHV
QQGGFPSSKDRVVASRFAVKCVKFIEQWNKKNTEAENMDYKILRFNYVNGVKEFTVPNED
ASAAVICVNGSKISFKPIAEIWEKETDVKLRKGHDIHWEEYNEIGDILSGRSMLRRKLQE
ESEQGSSTGNSTPLPASA
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgagcaatactatttacggtgttgctttccgttctttaagcacatctgatgag
cagctttataggaagacagctagattttaccattcgttggggttccaaacggtgaagttg
tacgacaactttaagaaccacgacgattcgcatttgattgttggtacttcgaagaattct
gtgaaggaatgctggttggagtcgttcaagctatcgcaagttgatgctgagggatttaga
gttccacagcaggaggcatcgaaccaggatcagagtgatggtgtgatgattaagttgaga
atggttgagagcgagccagctgttcaaaaggcggatgtgattgtgtactacacggtgagt
ttggaggaagtggccaagtttggtgagtctttggatgcgcacacggtgaagttggtggac
ccattgggcaacactatcttggtaactgacgaggttagcgggaagaagctcaatgcggct
gaattcatcgagccaaaggacacgtctgatgagcacaagatcacgattgacttgggagac
aaggatcagaagaaaaagaagatcgccgttatgacatccggtggtgactctcaaggtatg
aatgctgcagttcgtgcagttgtaaggaccggtatctactacgggtgtgatgtttatgca
gtttacgaaggttacgaaggtttggttaaaggtggtgatttattgaagaagatggaatgg
caagatgtccgtggatggctaagcgagggtggtactttgatcggtactgctcgtagtaaa
gagttcagagaaagatggggtcgtaagcaagctgctgctaacctaatagaacaaggtatc
gatgccttggtcgtggttggtggtgatggttccttaactggtgccgacttgttcagatcg
gaatggccatctttggtcgatgaattagtcaaggagggtaaatttaccaaggaacaggtc
gccccctaccacaacttgaccatcgttggtatggtcggttccattgacaacgatatgtct
ggtaccgattccaccattggtgcttactctgcattggaaagaatttgtgaaatggtggat
tacatcgacgccaccgccaagtcccactcaagagctttcgtcgtcgaagttatgggtaga
cactgtggttggttaggtttgatgtccggtatcgctactgcagccgactacatctttatc
ccagaaagagctgctccacacggcaaatggcaagacgagttgaagcgtgtttgccaaaga
catagagaaaagggccgtagaaacaacactgttatcgttgctgaaggtgctgtcgatgac
caattgaacccaattacagccgaacagattaaggatgtcttggttgagctaggtttggat
accaagattaccactttgggtcacgtgcaaagaggtggtaccgcagtggctcacgacaga
tggttggctaccatgcaaggtgccgatgctgttaaggccatcttggaaatgaccccagag
actccttccccattgatcggtatcttggaaaacaaggttatcagaatgccattggtggaa
tctgttaagctaactaaggaagtcgccacggccattgaagccaaggatttcgacaaggcc
atttccttgcgtgacacagaattcattgaattatacgacaacttcatctctaccacagtt
aacgatgacggttctcaattgctaccagagggtgaaagattaaacattgctatcgtccac
gtcggtgctccatctgctgccttgaacgctgctaccagagccgccactttgtactgtctt
gctcacggtcacaagccatatgctatcatgaacggtttcagtggtctaatacaaactggt
caagtcaaggaactttcatggatcgatgttgaagactggcacaacctaggtggttctgaa
atcggtaccaacagatctgtcgccgctgaagacatgggtacaattgcttactacttccaa
aagcataagttcgatggtatcatcatcatgggtggtttcgaaggtttcaagtctttgaag
caactaagagatggtcgtgaagaatacccaattttcaacattccaatgtgtctgatccca
gccactgtttccaacaacgttccaggtactgaatactccttaggtgcagacacatgtttg
aacgcattggtgaagtacactgacgctatcaagcaatctgctgcagcttctagacgtaga
gttttcgttgtcgaagtccaaggtggtcactctggttacgttgcatctttcaccggtttg
gtcaccggtgctgtttctgtgtacaccccagaaaagaagattgacttgcaatccatcaag
gaggatttggctctcttgaaggaaagtttcagaaacgaccaaggtgaaaccagaaacggt
aagatcttgattagaaacgaaatggcatccactgtctacaccacggaactactagcagac
ctaatcactgaacaatctaacaacagattcgccgtcaagactgctatcccaggtcacgtt
caacaaggtggtttcccatcctccaaggaccgtgttgtggcttccagattcgccgtcaag
tgtgtcaagttcattgaacaatggaacaagaagaacaccgaggcagaaaacatggactac
aagatcctacgtttcaactacgtcaacggtgtcaaggaattcaccgttcctaacgaagac
gcatctgccgccgtcatctgtgtcaacggatccaagatctccttcaagccaatcgcagag
atctgggaaaaggaaacagatgtcaagctaagaaagggtcacgacatccactgggaagaa
tataacgaaatcggagacattctttccggtagatctatgctaagaagaaagttgcaagaa
gaaagcgaacaagggtcctcaactggcaatagcactccgctaccagcctccgcttaa

DBGET integrated database retrieval system