KEGG   Kluyveromyces marxianus: KLMA_10383Help
Entry
KLMA_10383        CDS       T05269                                 

Gene name
SET2
Definition
(RefSeq) histone-lysine N-methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:kmx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    KLMA_10383 (SET2)
Enzymes [BR:kmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     KLMA_10383 (SET2)
Chromosome and associated proteins [BR:kmx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     KLMA_10383 (SET2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRI SET Caldesmon Med26
Motif
Other DBs
NCBI-GeneID: 34714048
NCBI-ProteinID: XP_022673903
LinkDB All DBs
Position
1:complement(771341..773479)
Genome map
AA seq 712 aa AA seqDB search
MTESSTETASFRQPKLFLDEKDMTEEAKKTYVGLDECSYTPRHMGNSKHEFMECDCFEDF
KNGLNHACGEDSDCINRATLIECVNGLCKHSCGEDCQNQRFQKKQYADISVFKTKRKGYG
VRANSDIQPHQFIYEYIGEVIPEEEFRKRMVKYDEMGFKHFYFMMLQTGEFIDATIKGCI
ARFCNHSCNPNAYVNKWVVNGKLKMGIFANRLISKGEEVTFDYNVDRYGANAQPCYCEEP
NCIGFLGGKTQTDAASLLPQNFADALGIKPSMEKKWMNMKKAKGEKIVKSDTTTVNVEFV
NSLDLEPCTKTEDVNRVMSVLLQVDDAFIAEKLLERIITTDDEAMHYQFIKLHGYLICSR
LLTMFEDKPHIVAKILNFLAVLPKTTKNGITQSGIDKKVEEIKGKDSEFKSVCEELLDKW
SKYETYTRISKKDVNENSKVIDLRRIRLPIGWELIHENGKPVYYNAQRQIKQSVPPTDSA
YRSNSNGNISNNGNGGGASDLKSRSGTPNGGTSRYSGSNKYIPPPTYGQMQQKRNLSPEE
YEKRKRMRLEWEQRELEQRKQREQEELKAKLEQEKLKKSELERIIEEANKQKEQEKLEKI
KQQKEEEEKRKLKKQTNHTSVVEAKWVKFFAKYVPNLIKNYQQEVGKELFKESAKNIVKS
LAQKEMKKGSSRLPPDELSQEKRAKVKTFSTQYMDRLIAKMKEKEKAKKTIT
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagtagtactgaaactgccagttttaggcagccaaaactatttcttgatgaa
aaggacatgacagaagaagcaaagaaaacgtatgttgggttagatgaatgtagttatact
cctaggcatatgggtaattcaaaacatgagttcatggaatgtgattgttttgaagatttt
aaaaatggtctaaatcacgcatgtggtgaagattctgattgtattaatagagccacacta
atcgaatgtgtgaacgggctatgtaaacattcatgcggtgaggattgtcaaaaccaacgg
ttccagaagaagcaatacgcagatatatctgtgttcaaaactaagagaaagggctatggt
gtgcgtgctaactcagatatacagccacatcagttcatttacgaatacattggtgaagta
ataccggaagaagagtttcggaaacgtatggttaagtacgatgaaatgggattcaagcac
ttttactttatgatgttacagacaggtgaattcatagatgcaacgatcaagggttgcatt
gccagattctgtaaccattcttgtaatcctaatgcatatgttaataagtgggttgttaac
ggtaagttgaaaatgggtattttcgctaataggctcatttcgaagggagaagaggttaca
tttgattacaatgttgatagatatggagcaaacgctcaaccgtgttattgtgaggaaccc
aactgtataggtttccttggtggtaagacacaaaccgacgcggcttctttgttacctcaa
aactttgcagatgcactaggtatcaaaccttcaatggagaagaaatggatgaatatgaag
aaggccaagggagagaaaattgtcaagagtgacactacaactgttaatgtcgaatttgtt
aattcgcttgacttagagccatgtacgaaaaccgaagatgtcaatagagtgatgagtgtg
ctattgcaagtggatgacgcattcattgcggaaaaattacttgaaagaatcatcacgaca
gatgatgaggctatgcactatcaattcatcaagttacatgggtatttgatatgtagtcga
cttttgacaatgtttgaagacaaacctcacattgttgcaaagatcttaaactttctagca
gtgctaccaaaaactaccaagaatggtattacgcaatcaggtattgacaaaaaggtggag
gaaataaaaggtaaggattcggagttcaaatctgtttgtgaagagcttcttgataaatgg
tctaagtacgagacttacacaaggatatcaaagaaagacgttaatgaaaacagcaaggtg
atagatctacggagaatacgtttgcccattggatgggagcttatccatgaaaatggtaaa
ccagtgtattataacgctcaaaggcaaatcaaacaatcggttcctcccaccgattccgct
tatagatcgaactcgaacggcaacatcagcaataacggaaacggcggaggagcttcggac
ttaaaatctcgttcgggtacaccaaatggtggtaccagtcggtacagcggttccaataaa
tacattcccccaccaacgtatggccaaatgcaacaaaagaggaacttatcgccagaggaa
tacgaaaagaggaaaaggatgaggctagaatgggaacaaagagaactagagcaacgtaaa
caaagagaacaagaagaactcaaagccaagctcgagcaggagaaactaaagaagtcggaa
ttggagcggatcattgaagaagcaaacaagcaaaaagaacaagaaaagcttgaaaagatc
aaacaacaaaaggaagaagaggagaaaaggaagcttaaaaaacagactaatcacaccagc
gtagttgaagcgaaatgggtgaaattcttcgccaaatacgttccaaatctaataaaaaat
taccaacaagaagtcggtaaggaactcttcaaagaatcagctaaaaacatagtgaaatct
ctagcccaaaaggagatgaagaaaggtagctcgagattgcctccagacgaactctcgcag
gagaaacgcgctaaagtcaaaaccttttcgacacaatacatggaccgtttgatagcgaag
atgaaagagaaggaaaaggctaaaaaaacaataacatag

DBGET integrated database retrieval system