KEGG   Kluyveromyces marxianus: KLMA_20664Help
Entry
KLMA_20664        CDS       T05269                                 

Gene name
RAD10
Definition
(RefSeq) DNA repair protein RAD10
  KO
K10849  DNA excision repair protein ERCC-1
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    KLMA_20664 (RAD10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kmx03400]
    KLMA_20664 (RAD10)
DNA repair and recombination proteins [BR:kmx03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     KLMA_20664 (RAD10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad10
Motif
Other DBs
NCBI-GeneID: 34715125
NCBI-ProteinID: XP_022674980
LinkDB All DBs
Position
2:1357499..1358170
Genome map
AA seq 223 aa AA seqDB search
MSDDTTSFESILANVRKRRAEFEQPNLTPVQQQQGLGSQPQPQAVSKNSTESNAKYTSTN
QGSKPIVNSFNQQHDDSNGNNIIIHNQRKANTSQTLNNAASASKTMFVSSSQTGNPLLKS
LVNVNWRYVKSTPTAPVNYDYQIRGRNVVFLSLRYHKLHPEYIGKKLLPFRRSEGNILLC
VVDVENSEDILRELNKVCMFQGFTMLLAFSFEQAGNYLTFMNK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgatacaacttcattcgaaagcatcctagccaatgtcaggaaaagaagagcc
gaatttgaacaaccaaatttaacaccggtgcagcaacagcagggactcggatcacaaccc
caaccacaagctgtatcaaaaaattctacagaatccaatgccaaatacactagtacgaat
caggggagtaaacctatagtaaactcgttcaaccagcagcatgacgattctaatggaaat
aacattataattcacaatcaaagaaaagcaaacactagtcaaaccctaaataatgctgct
agtgctagtaagaccatgtttgtgagctcttcacaaaccgggaatcctctattgaaaagt
ttagtcaacgtgaattggagatatgtaaagtccactccaaccgcgccagtcaattacgac
tatcagataagaggacggaatgtagtatttctttcgttgaggtatcacaaattacatcct
gaatatatagggaagaaactactaccatttagaaggtcagaaggaaatattttgttatgt
gttgttgatgttgagaattcagaggatatcctaagagagttgaacaaagtatgtatgttt
caagggtttacgatgcttcttgctttttcattcgagcaagcaggcaactatttgacattt
atgaacaagtag

DBGET integrated database retrieval system