KEGG   Kluyveromyces marxianus: KLMA_30556Help
Entry
KLMA_30556        CDS       T05269                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00250  Alanine, aspartate and glutamate metabolism
kmx00410  beta-Alanine metabolism
kmx00430  Taurine and hypotaurine metabolism
kmx00650  Butanoate metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
Module
kmx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KLMA_30556 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLMA_30556 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KLMA_30556 (GAD1)
   00430 Taurine and hypotaurine metabolism
    KLMA_30556 (GAD1)
Enzymes [BR:kmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KLMA_30556 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC RTTN_N
Motif
Other DBs
NCBI-GeneID: 34715827
NCBI-ProteinID: XP_022675683
LinkDB All DBs
Position
3:complement(1192739..1194442)
Genome map
AA seq 567 aa AA seqDB search
MLHKELDVEESKRFFHHSHGPMKGDPDGFGLLPDGSRVQSVKDTRVDKYSVPNKGLHDEN
VYNLIKNELRLDGNPVLNLASFVNTFTDDFAQRLIDENLNKNLADNDEYPQLIHMNERCI
AMLARLWQADTTRDKPLGCATTGSSEAIMLGGLAMKRQWEKKMKAAQKPITKPNIVMSSA
CQVALEKFARYFDVECRLVPVDTEYGYHLNPNKLWDYVNENTIGIFVILGTTYTGHLENV
EEVGKVLDQIEAQNPEWSNKNIPIHVDGASGGFIVPFAFTESQMAKYGLGRWGFNHPRVV
SINTSGHKFGLTTPGLGWIVWKNDEYLLPELRFKLKYLGGIEETFNLNFSRPGFQVIHQY
YNFLTLGKQGYYEKFNQSIFVARSFAWKLLRDPDLKDIFEVVSCLHEKMNSSTIANSIDD
YWESPHQFKPGIPLCAFKLSEKFKAEHPEIPQSIISTLLRQKGWIIPNYPLPQSTDGSDK
KEVLRVVFRIEMKLDMCLLLVQDIFAIIEKLIKSYEYLNIHSTNNNHAVFKILSTLSNAD
MDAVIQDLSEIEIEKQKHVKKNYRGTC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacaaggaactagacgttgaagaatcaaagagatttttccatcatagccatggg
cctatgaagggtgacccagatgggttcggactgttgcctgatggttcaagggtacagagt
gttaaggataccagggtggataaatattctgtccctaataaagggttacatgatgagaat
gtgtacaatttaatcaaaaatgagctaagactagacggtaatcctgtcctaaatttggca
agtttcgtcaatacctttacagatgactttgcccaaagacttatcgatgaaaacttgaat
aagaacctcgcggataatgatgagtatccccagttgatccatatgaatgaaagatgcatt
gccatgttggcaaggttgtggcaggcagacacaactagggataagccattaggctgtgct
acaacaggatctagcgaagcaatcatgctaggtggtttagcaatgaagaggcaatgggag
aaaaagatgaaagctgcacagaaacccattactaaaccaaacatcgttatgtcgagtgca
tgtcaagtcgctttggaaaagtttgcccgttattttgatgttgagtgtagattggtacct
gttgacaccgagtatggctatcatctaaaccctaacaaattatgggactacgttaatgag
aatacaattggtatattcgtcattctaggaactacatacacagggcatttagagaatgtg
gaggaagtagggaaagtgttagatcaaatagaagcacaaaatcccgagtggagcaataaa
aatattccaattcatgttgatggtgcttctggtggtttcattgttcctttcgcttttaca
gaatctcaaatggccaaatatggtcttggccgttggggtttcaaccatccaagagttgtt
tccattaacacttccggtcataaatttggattaactacccctggcttagggtggatcgtt
tggaagaatgatgaatatttgctaccagagttaagattcaagttaaaataccttggagga
atcgaagagacctttaacttgaacttctctagaccaggtttccaggtgattcaccaatac
tacaatttcctaacattaggtaagcaaggttactatgagaagttcaaccaatcaattttc
gttgctcgttcctttgcttggaaactactaagggatcctgacttaaaggacatttttgaa
gtcgtcagttgtttacacgaaaaaatgaacagttctaccatcgccaatagtatcgacgat
tattgggagagccctcatcaatttaagccaggtattccattgtgcgcattcaaactatcc
gaaaagttcaaagcagagcatcctgaaattcctcagtcgatcatctcaactttgttgaga
caaaaaggttggatcattcctaattaccctttgcctcagtccactgatggaagcgacaaa
aaggaggttttgagagtcgtgttcagaattgagatgaaacttgatatgtgcttactgttg
gttcaagatatctttgcaattatcgaaaaattgataaagtcgtacgagtatttgaacata
cattctacaaataacaatcacgctgtgttcaaaatactaagcactctatctaacgcagat
atggacgcagtgattcaagacctcagtgaaattgaaattgagaaacaaaaacatgtgaag
aagaactatagaggcacttgttaa

DBGET integrated database retrieval system