KEGG   Kluyveromyces marxianus: KLMA_40054
Entry
KLMA_40054        CDS       T05269                                 

Gene name
RIM11
Definition
(RefSeq) serine/threonine-protein kinase MDS1/RIM11
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    KLMA_40054 (RIM11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmx01001]
    KLMA_40054 (RIM11)
Enzymes [BR:kmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KLMA_40054 (RIM11)
Protein kinases [BR:kmx01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   KLMA_40054 (RIM11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase APH
Other DBs
NCBI-GeneID: 34716049
NCBI-ProteinID: XP_022675905
LinkDB
Position
4:complement(join(112686..113896,114939..115443))
AA seq 571 aa
MLKKIKEIIQPTTNPGGLSFSLSLSKSKRKIAAQIPPNSDKEEYDKKRAQAKIEKLHRLY
THELDVELVLKHLSIEEEHREHVTCPSSGTSTTSATSITTNSTTTTSTTSTTATSAAASD
MGTFSTAPTNDTSASNSDKVRPPDPDAGAGACLDHIPRLHSNNVNSNNIPQDKTNKQKKI
EVVMVEVQTASASVTNGTGTGTGNGNANANANANGVNTETCTQRKVILGHSNPEQSVVIS
CGTPEIVGNGSFGVVFRTNVKETGEDVVIKKVLQDRRFKNRELEIMKMIKHRNLIDLKYY
FLEQSDQDLYLNLIVDYMPMSLYQRLKEFICVHRPMDRYEIKIYMFQLFKSLNYLHQVVG
VCHRDIKPQNILVDPSTFLLKICDLGSAKQLKPNEPNVSYICSRYYRAPELIFGATNYTT
KIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGTPTRDEICAMNENYSEHKFPQI
RPIPLNKIFKKETQETIDLLYYIMKYDPNIRYSALQCMFNSEYFSDILDPQKSNASLIES
LQLLDFEENELAGLTAEDLARFGAKVIIPSS
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgctcaagaagattaaagagatcattcaacccacaacgaaccctggcggcctctcgttt
tctctttctttgtcaaagtccaagcgcaaaattgccgcccaaattcctcccaattctgac
aaagaagaatacgacaagaaacgcgcccaagcaaaaatcgaaaagttgcatcgcttgtac
acccacgaactagatgttgagctggtcctcaaacatctctccatagaagaagaacaccgc
gagcacgtgacgtgcccttcttccggcaccagtactaccagcgctaccagtatcactact
aattctactactactactagtactactagtactacagctaccagtgccgcagccagcgac
atgggcactttcagcactgctccgacaaacgacacaagcgccagcaattcggacaaggtt
cgccctccagaccctgacgcaggggctggtgcatgcctagaccatatcccacgcttgcat
tccaacaatgtgaactctaataacatacctcaggacaaaacgaataagcagaagaaaatc
gaggtagtcatggtagaggtgcagacggcttcagcatctgttacaaatggcactggcact
ggcactggtaatggtaatgccaatgccaatgccaatgccaatggcgtcaacacggagaca
tgcacgcagaggaaggtgattctgggccattctaaccctgaacagtcggtggtgatctcg
tgcgggacgccggagatagtgggcaacgggtcctttggagtggtgttcaggacgaacgtc
aaggaaactggagaagacgttgttatcaagaaggtgttgcaagatcggaggttcaagaac
agagaattggagatcatgaagatgatcaagcacaggaacttgatcgacttgaagtactat
ttcctagaacaatcggaccaggacttgtatttgaatctaattgtcgattacatgcccatg
tcgctataccagcggctgaaggagttcatctgcgtgcataggcccatggaccgctacgaa
atcaaaatttacatgttccagttgttcaagtcgttgaactatttgcatcaggtggttggc
gtgtgccatagggacatcaagccacagaacattttggtcgacccgtctacttttctcttg
aaaatatgcgatttgggttccgcaaagcagttgaagcccaacgagccaaacgtatcgtac
atttgttcgcgttactacagagccccagagttgatctttggcgccacaaactacactaca
aaaatagacatatggtctgcagggtgcgtcatggcagaactgctcttgggacagcctatc
ttccccggtgagtcaaagatcgaccagttggtcgaaatcatcaaggttcttggcacccca
acaagagacgagatctgtgccatgaacgaaaactactcagaacacaagttcccacagatc
agacccatcccattaaacaagatcttcaagaaagaaacccaggaaacaatagacttgttg
tattacatcatgaagtatgatcccaacatcagatacagtgctctccagtgcatgttcaat
tcagagtacttttcggacatactcgacccacagaaatcaaacgcttcgctaattgagtct
ctacagcttctagactttgaagaaaacgagttggctggcctgacggccgaagacttggca
aggtttggcgcaaaagtaataataccatcaagctga

DBGET integrated database retrieval system