KEGG   Kluyveromyces marxianus: KLMA_40470Help
Entry
KLMA_40470        CDS       T05269                                 

Gene name
IDP1
Definition
(RefSeq) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00020  Citrate cycle (TCA cycle)
kmx00480  Glutathione metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
kmx01210  2-Oxocarboxylic acid metabolism
kmx01230  Biosynthesis of amino acids
kmx04146  Peroxisome
Module
kmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLMA_40470 (IDP1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KLMA_40470 (IDP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KLMA_40470 (IDP1)
Enzymes [BR:kmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KLMA_40470 (IDP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 34716456
NCBI-ProteinID: XP_022676315
LinkDB All DBs
Position
4:1064175..1065464
Genome map
AA seq 429 aa AA seqDB search
MKTTVINVHRQFSSSAMAGLRKIKVQTPIVELDGDEMTRIIWDKIKQKLILPYLDVDLKY
YDLSVTNRDATDDKVTVDSANAIKKYGVGVKCATITPDEARVKEFNLKKMWKSPNGTIRN
ILGGTVFREPIVIPRIPRLVPGWEKPIVIGRHAHGDQYKATDLIVPGPGKLELVYKPGDG
SETKTLEVYDYKGPGVALAMYNTDESIRGFAHSSFKLAIAKKLNLYLSTKNTILKQYDGR
FKDIFQEVYDSDYKAEFEKLNIWYEHRLIDDMVAQMIKSKGGFILAFKNYDGDVQSDIVA
QGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAK
RGELDNTPEVVKFANLLESSTLNTVQEDGIMTKDLALACGKSDRSSYVTTDEFLDAVEAR
FKNDIKSLQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccacagtcatcaatgttcaccgccagttttccagctcagctatggcaggattg
cgcaaaatcaaggtgcagacaccaattgttgagttagatggtgatgagatgaccagaatt
atttgggacaaaatcaagcagaagcttattttgccatacctggacgtggatttgaaatac
tacgatctttcagtgaccaaccgtgatgccacagatgacaaagttactgttgattctgcg
aatgcgatcaagaaatacggcgtaggtgtcaagtgcgccaccattacgccagatgaagct
cgtgtgaaggagttcaacttgaagaagatgtggaagtcgcctaacggtacaatcagaaac
attctaggaggcactgtgttccgtgaaccaattgtgattccaagaattcctagactagtg
ccagggtgggagaagccaattgtcattggtagacacgctcatggtgaccagtacaaggcg
actgatttgattgtcccaggcccaggtaagctagagttggtttacaagccgggcgatggc
tctgagaccaagacgctagaggtgtacgactataagggccctggtgttgctttggctatg
tacaacacagacgaatccatccgtggcttcgcccattcatctttcaagttggctattgcc
aagaagttgaacctctacttgtctaccaagaacaccattttgaagcagtacgacggtaga
tttaaggatatcttccaagaggtgtatgacagcgactacaaggctgaattcgaaaagcta
aacatctggtacgaacaccgtttgatcgatgacatggttgctcagatgatcaagtccaag
ggtggtttcattttggccttcaagaactacgacggtgacgttcaatctgatatcgttgct
caagggttcggatcccttggtttgatgacgtcagtgctagtgaccccagacggcaagacc
ttcgaaagtgaagccgcacacggtaccgttaccagacactacagacaataccaacagggt
aaggaaacgtccaccaactcgattgcatccatctttgcttggaccagaggtctagctaaa
agaggtgaattggataacacaccagaagtcgtgaaattcgccaacttgttggagtcttcc
actctaaacactgtccaagaagacggtattatgaccaaggacttggctctagcttgtggc
aagtctgatagatccagttacgttaccactgacgaatttttggatgctgtcgaagccaga
ttcaagaacgacattaagtctttgcaatga

DBGET integrated database retrieval system