KEGG   Kluyveromyces marxianus: KLMA_50033Help
Entry
KLMA_50033        CDS       T05269                                 

Gene name
HOS3
Definition
(RefSeq) histone deacetylase HOS3
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
kmx  Kluyveromyces marxianus
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kmx03036]
    KLMA_50033 (HOS3)
Enzymes [BR:kmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLMA_50033 (HOS3)
Chromosome and associated proteins [BR:kmx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KLMA_50033 (HOS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 34716649
NCBI-ProteinID: XP_022676506
LinkDB All DBs
Position
5:complement(73062..75227)
Genome map
AA seq 721 aa AA seqDB search
MSQDPLYEFKQQFEKFVASNPNVSSVTSAASRIPESSKAVVVLSPYSLSHQFPRYWVSKS
YKKTIVERPERLLACCIGVAAAITMYPALFTVKTSNRHKTSLLAPHVLKVHGKDWPKKLL
KLCKESERKLERQEIEVPEDWNVGDIYLSRQTIAALEGSIGALEVGIDSIFEGASIEQTS
NRAFVAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKYDVTHAVILDFDLHHGDGTQDI
CWKRAGFRPDEFASEAGSDSGSAELENEDDDEYDEFGKTFAKFPKVGYFSMHDINSFPTE
LGYATKENIRNASTCIMDAHDLNIWNVHLQPYKDEEEFVKLYQTKYRSIFAKADEFFKNA
KAEMKNGGFRFKGLVLISAGFDASEYEQQSMQRHNVNVPTSFYNMFTKDALKLAQMHSSG
KILSIMEGGYSDGAISSGVFSHLIGFQNQNWINEWGSEQVVKEITRGCKPRWKPYKTKKA
RDVIRIWAEEVIMLGRSMIPEFKSVLFEPEPPIVHPEVRLTRSKYHETLVKKEQDIPRAE
TPTPPPTRSEQVTAKTEEIPFVEQVLPSDDENDDDEDYQYDEELNKTFNRTVEDITIDDI
SRHLETLDILQLSDEDEVESTRLRNNGDPKVVTNHRTSPVNNSHTLDPASGTRHLSGNGN
VSGVPSGNYKIPSSTTTRHLRSNRHSRLLNFDDSDISMISHASPPRSKTRSSGKSNGHSN
W
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggatccgttatatgagttcaaacaacagtttgagaaatttgttgcgagtaac
cccaatgtgtcttcggtgacttctgctgcttcaaggattcctgaatcgtcgaaagctgtt
gtggtattatcgccttactctctttctcatcagtttccgcgttattgggtttctaagtcc
tacaagaaaactattgtcgagcgtcctgagcgtctcctggcatgctgtattggtgtagcg
gccgcgattacgatgtatccggctttgttcacggttaagacttcgaaccgtcacaagact
tcattattggcaccacatgtgctgaaagtacatggtaaggattggcccaaaaaactattg
aagctttgtaaagagtctgaaaggaagctagagagacaagaaattgaggttccagaagac
tggaatgtgggagacatttacctatcgagacagacgattgctgcattagaaggaagcatt
ggagcacttgaagttggtatcgactccatcttcgaaggtgcaagtattgaacagacttca
aatcgtgctttcgtggctatcagaccacctggacatcattcacacgcatctactccatca
ggcttctgtttacttaacaatgcacatattgctattgaatatgccttcgaaaaatatgac
gttacccacgcagtgattcttgattttgatctacaccatggggacgggacccaggatata
tgttggaaacgtgctgggtttagaccagatgagtttgcttcggaagcaggctcggattca
ggctctgctgagctagaaaatgaagatgatgatgaatatgatgaatttggtaagacattc
gccaaattccccaaagtgggctatttctccatgcatgacattaattctttcccaacagag
ctaggatacgctactaaggaaaacatcaggaacgcttctacttgtatcatggatgcgcat
gacttaaatatatggaatgtgcatttgcaaccatataaggatgaggaagagtttgttaaa
ttataccaaactaaatatagatcaatctttgctaaagctgatgaattctttaagaacgcc
aaagcggaaatgaagaatggcggatttcgcttcaagggtcttgttctcattagcgctggt
tttgatgccagtgaatacgaacagcaatctatgcaaagacacaatgtaaatgttcctaca
agtttctacaacatgttcacaaaagatgcacttaaattggcgcagatgcactctagtggt
aagattctctcaataatggaaggtggctattcggacggcgcaatatcttccggtgtcttt
tctcatttaatcggtttccagaatcagaactggattaatgaatggggctctgaacaggtt
gttaaagaaattaccagaggctgtaagccaagatggaaaccatacaaaaccaagaaggct
cgtgatgtaataagaatttgggctgaagaggtgattatgttaggtagaagcatgattcct
gagttcaaatcggtcctttttgagccggaaccaccaattgtacatccagaggtgagactc
acaaggtccaagtaccacgaaactcttgtaaagaaggagcaagatattccaagagcagaa
acacctaccccacctcctactcgtagcgagcaagttaccgctaaaaccgaagaaattccg
tttgttgaacaagttctgcctagtgatgatgaaaatgatgatgatgaagactatcaatat
gacgaagaactaaataaaacgtttaatagaactgttgaggatatcaccattgatgacatt
tcaagacatttggaaacgttagatattttacaattgtccgatgaagatgaggtcgaaagt
actagactgagaaacaatggtgaccccaaggtcgtcactaaccatcgcacctctccggtt
aataactcacatacattggatccagcatccggtactaggcatctgagcggaaacgggaat
gtttctggtgtgccatctggaaattacaaaatcccctccagcaccacaactcgccatctg
cgcagtaatcgacattcaagacttctgaacttcgatgacagtgatatatccatgatatcg
cacgcctctccgcctcgatccaaaacccgttcctcaggtaaaagcaacggacattccaac
tggtaa

DBGET integrated database retrieval system