KEGG   Kluyveromyces marxianus: KLMA_60412Help
Entry
KLMA_60412        CDS       T05269                                 

Gene name
RAG5
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00010  Glycolysis / Gluconeogenesis
kmx00051  Fructose and mannose metabolism
kmx00052  Galactose metabolism
kmx00500  Starch and sucrose metabolism
kmx00520  Amino sugar and nucleotide sugar metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
Module
kmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kmx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLMA_60412 (RAG5)
   00051 Fructose and mannose metabolism
    KLMA_60412 (RAG5)
   00052 Galactose metabolism
    KLMA_60412 (RAG5)
   00500 Starch and sucrose metabolism
    KLMA_60412 (RAG5)
   00520 Amino sugar and nucleotide sugar metabolism
    KLMA_60412 (RAG5)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KLMA_60412 (RAG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmx04131]
    KLMA_60412 (RAG5)
Enzymes [BR:kmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KLMA_60412 (RAG5)
Membrane trafficking [BR:kmx04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    KLMA_60412 (RAG5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 34717627
NCBI-ProteinID: XP_022677484
LinkDB All DBs
Position
6:complement(859334..860791)
Genome map
AA seq 485 aa AA seqDB search
MVHLGPKKPPARKGSMADVPADLMEQIHGLETLFTVKTEKMRAIVKHFVSELDKGLSKKG
GNIPMIPGWVVESPTGKETGDFLALDLGGTNLRVVLVKLGGNHDFDTTQNKYRLPDHLRT
GTSEQLWSFIAKCLKDFIEEWYPEGVSEPLPLGFTFSYPASQNKINEGVLQRWTKGFDIE
GVEGHDVVPMLQEQIKKLNIPINVVALINDTTGTLVASLYTDPETKMGIIIGTGVNGAYY
ESVKNIEKLEGKLPSDITTDMLMAINCEYGSFDNEHLVLPRTKYDVMIDEQSPRPNQQAF
EKMTSGYYLGEIMRLVLLDLHSSGFIFKDQDISKLEVPYVMDTTYPAKIEEDPFENLEDT
YELFKTTLNIETTVIERKLIRKLAELVGTRAARLTVCGVSAICNKRGYTEAHIAADGSVF
NKYPGYKEKAAQALKDIYDWKVEKMEDHPIKLVAAEDGSGVGAAIIAALTQKRLAAGKSV
GIEGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaagccaccagccagaaagggttccatggctgatgttcca
gctgatttgatggaacaaatccacggtttggaaactttgttcaccgtcaagactgaaaag
atgagagccattgtgaagcacttcgtctctgaattggacaagggtttgtccaagaagggt
ggtaacattcctatgattccaggttgggttgtcgaaagtccaactggtaaggaaactggt
gatttcttggcccttgacttgggtggtactaacctgagagttgttctggtcaagttgggt
ggtaaccacgactttgacaccactcaaaacaagtacagattgccagaccacttgagaact
ggtacttctgagcaattgtggtctttcattgccaagtgtttgaaggacttcattgaagaa
tggtacccagaaggtgtctctgagccattgccattgggtttcaccttctcttacccagcc
tcccaaaacaagattaacgaaggtgtcttgcaacgttggaccaagggtttcgatattgaa
ggtgtcgaaggccacgatgtcgtcccaatgctacaagagcaaatcaagaagctgaacatc
ccaattaacgtcgttgccttgatcaacgataccaccggtaccttggttgcttctctatac
actgacccagaaaccaagatgggtatcatcattggtactggtgtcaacggtgcctactac
gaaagtgtcaagaacatcgaaaagctagaaggtaagttgccatctgacatcaccactgat
atgctaatggccatcaactgtgaatacggttccttcgacaacgaacacctggtcttgcca
agaaccaagtacgatgttatgatcgatgaacaatccccaagaccaaaccaacaagccttc
gaaaagatgacttccggttactacttgggtgaaatcatgcgtctagtcctattggacttg
cactccagcggtttcatcttcaaggaccaagatatttccaagttggaagttccatacgtc
atggacaccacctacccagccaagatcgaagaagatccattcgaaaacttggaagacact
tacgaattgttcaagactactttgaacattgaaaccaccgtcatcgaaagaaagttgatc
agaaagttggctgaattggtcggaacaagagccgctagattgaccgtttgtggtgtttct
gctatctgtaacaagagaggctacactgaagcccacattgctgccgatggttccgtcttc
aacaagtacccaggttacaaggagaaggctgctcaagctttgaaggacatctacgactgg
aaggtcgaaaagatggaagaccacccaatcaagttggtggctgctgaagatggttctggt
gttggtgctgctatcattgccgctttgacacaaaagagattggctgccggtaagtctgtt
ggtatcgaaggtgcttaa

DBGET integrated database retrieval system