KEGG   Kluyveromyces marxianus: KLMA_60541Help
Entry
KLMA_60541        CDS       T05269                                 

Gene name
KGD1
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00020  Citrate cycle (TCA cycle)
kmx00310  Lysine degradation
kmx00380  Tryptophan metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
Module
kmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLMA_60541 (KGD1)
  09105 Amino acid metabolism
   00310 Lysine degradation
    KLMA_60541 (KGD1)
   00380 Tryptophan metabolism
    KLMA_60541 (KGD1)
Enzymes [BR:kmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     KLMA_60541 (KGD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 34717750
NCBI-ProteinID: XP_022677607
LinkDB All DBs
Position
6:1154008..1157070
Genome map
AA seq 1020 aa AA seqDB search
MLRTIRSSQRLLHASRFSHVGGMSAVANINANRTVLLRGFASGSSMDNFLSTTNAAYIDE
MYEAWQKDPSSVHVSWDAYFKNMGNLNIPASSAFTAPPTLMPLPTGPGVPHDLPLGGSLH
AVDQDVTTHLKVQLLCRAYQVRGHQKAHIDPLQISFGDDKSKPLPRELTLEHYGFTEKDL
DRDITLGPGILPRFATETRKTMKLREIIAALEKLYCSSYGIEYIHIPSREQCEWLRERIE
IPKPYNYTVDQKRQILDRLTWATSFETFLSTKFPNDKRFGLEGLEGVVPGIKTLIDRSVE
LGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFKGSVTPEEFEGSGDVKYHLGMNYQRP
TTSGKYVNLSLVANPSHLEAADPVVLGRTRAIQFSKNDIGKYEKAMSVLLHGDAAFAAQG
VVYETMGFLHLPAYSTGGTIHIITNNQIGFTTDPRFARSTLYPSDLGKVIDAPIFHVNAN
DVEALTFTFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYQKISKQKSVID
VYTEKLVSEGSFTKQDIDEHKKWVWGLFEEAYEKGKDYKPTSREWLTAAWEGFKSPKALA
SEILPHEPTNVDAETLKKIGKVISSWPENFEVHRNLKRILSNRAKAVESGEGIDWSTGEA
LAFGSLLLEGYHVRVSGEDVERGTFSQRHAVLHDQKSENVYTPLQHISDKQAEFTICNSS
LSEYGCMGFEYGYSLTNPDYFVQWEAQFGDFANTAQVIIDQFIAGAEVKWKQRSGLVLSL
PHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQDCNFQIVYPTTPANLFHIL
RRQQHRQFRKPLALFFSKQLLRHPLARSQLSEFTEGGFQWIIEDVELGKSIGTKEEIKRV
VLLSGQVYTALHKKREAIQDKTTAFIKIEQLHPFPYAQLRDALNSYPNLQDIVWCQEEPL
NMGGWAYAQPRLETTLKETDKYKDFAVRYAGRNPSGSVAAGSKALHTAEEEAFLKEVFGQ
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaactataaggtcgtctcagcgtttgttgcacgcttctagatttagccatgtt
ggtggcatgtctgctgttgcgaacataaatgccaatcgtactgttttgctacgtggtttt
gctagtggatcttccatggacaatttcttgtcaactaccaacgctgcgtatatcgatgaa
atgtacgaggcctggcaaaaggacccaagctctgtccatgtgtcttgggatgcctatttc
aaaaatatgggtaacttaaatattccagcttcttctgcatttactgcgccaccaactcta
atgcctctgccaactggcccaggtgtaccacacgacctacctctaggtggatctctacat
gctgttgatcaagatgttaccacccacttgaaagtccaacttttgtgtcgtgcctaccaa
gttagaggtcatcaaaaggcacatatcgatccattacagatctccttcggtgatgataaa
agcaagcctttacctcgcgagttgactttagagcactatggcttcacagaaaaggacttg
gacagggacattacattgggccctggtatcttgcctcgttttgctactgaaaccagaaag
accatgaagttgagagagattattgcagctttggaaaagttatactgttcaagttatggt
attgaatacattcatattccatctagagaacaatgtgaatggttaagagaaagaattgag
attccaaagccttataactataccgttgaccaaaagagacaaatcttagatagactgact
tgggcaacttcattcgaaactttcttgtccacaaagttccctaatgataagagatttggt
ttggaaggtttggaaggtgttgttcctggtatcaagaccttgattgaccgttccgttgag
ttgggtgttgaagatgtggtcttgggtatggctcatcgtggtagattaaacgtcttatct
aacgttgttcgtaagccaaacgaatccatcttctcagaattcaagggttccgttacccca
gaagagtttgaaggttccggtgatgtcaaatatcatttgggtatgaactaccaaagacca
accacatctggtaaatacgttaacctttccttagtcgcaaatccatcccatttggaagct
gcagaccctgtcgtcttgggtagaacaagagcaatccaattctctaagaatgatattggt
aaatatgagaaggctatgagtgtgttgttgcatggtgatgctgcgtttgccgctcaaggt
gttgtttatgaaactatgggtttcttacatttgcctgcatactctactggtggtactata
catattattaccaataaccaaattggtttcacaactgatccaagattcgctagatctacg
ttatatccatctgatttaggtaaggttattgatgcacctatcttccacgttaatgctaac
gatgtggaagctttgacctttacattcaacttggcagctgaatggagagctaccttccac
accgatgctatcattgatgttgttggttggagaaagcatggtcataatgaaactgaccaa
ccttcgtttactcaaccattaatgtaccaaaagatctcaaagcaaaagtctgtcattgat
gtttacaccgaaaagttagtttctgaaggttcattcacaaagcaggatattgatgaacac
aagaaatgggtttggggcctatttgaagaagcttatgaaaagggtaaagactacaagcca
acgtctagagaatggttgacggctgcttgggaaggtttcaagtctccaaaggccttggca
agcgagattttgcctcatgaaccaaccaatgtagatgctgaaactttaaagaagattggt
aaggttatctcttcttggcctgaaaactttgaagttcacagaaacctgaagagaattctt
tctaacagagccaaggctgtagagtctggcgaaggtattgactggtctaccggtgaagcc
ttggccttcggttccttgttgctagaaggttaccacgttagagtttctggtgaggatgtt
gaaagaggtaccttctctcaaagacatgcggtcttgcacgaccaaaaatctgagaatgtg
tacacacctttgcagcacatttctgacaaacaggctgaattcactatctgtaactcttca
ttatctgagtacggttgtatgggtttcgaatatggttattctttgactaacccagactac
tttgttcaatgggaagcacaatttggtgattttgccaacactgcccaagttatcattgat
caattcattgcaggtgctgaagtcaagtggaagcaaagatccggtttagttttgtcctta
cctcatggttacgatggacaaggtccagagcactcatccggtagactagaaagattcttg
caattggctaacgaagacccaagatacttcccaagtgaagaaaagttgcaaagacaacat
caagattgtaacttccaaattgtctacccaactaccccagctaacttattccatatttta
agaagacaacaacacagacaattccgtaaaccattggccttgttcttctctaaacaattg
ctacgtcatccattagccagatctcagttgagtgaattcactgaaggtggcttccaatgg
atcattgaagatgttgaactaggtaagtccatcggaacaaaggaagaaatcaagagagtt
gttttactatcaggtcaagtttacactgcattgcacaaaaagcgtgaggctattcaagac
aagaccactgcctttattaagattgagcaattgcacccattcccttacgctcaattgcgt
gacgctctaaactcttatccaaacctacaagatattgtttggtgtcaagaagagccattg
aacatgggtggatgggcctatgctcaaccaagattggaaactactttgaaggaaactgat
aagtacaaggatttcgctgttagatatgctggtagaaacccaagcggctctgtcgcagca
ggttctaaggccttgcacaccgctgaagaagaagctttcttgaaagaggttttcggtcag
taa

DBGET integrated database retrieval system