KEGG   Kluyveromyces marxianus: KLMA_80141Help
Entry
KLMA_80141        CDS       T05269                                 

Gene name
SGA1
Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00500  Starch and sucrose metabolism
kmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLMA_80141 (SGA1)
Enzymes [BR:kmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     KLMA_80141 (SGA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 34718338
NCBI-ProteinID: XP_022678195
LinkDB All DBs
Position
8:complement(309160..310947)
Genome map
AA seq 595 aa AA seqDB search
MGGATMMLGSKYRGENKVTKTTHFFVSFVCISSFLVYYFLFSPLRAGYYENQFSDGSGQY
IQVIDFNKVSDFQLQPIPFSKNISRTDFNQWLKDQERVSFERMFDNICNEESSGKFDNCF
PGVVFASPSKSKPDYFYHWIRDGAITINTLINTYSEVDKERTLKTVLNYVNASIDLQHRS
NPSGPVDDPLLRNLGEPKYHVDNSPFEQVWGRPQNDGPPLRAIALLNFLNSMNVSSSSDA
NSDYQWIFDDLITLDLKFVLYNWHVSSFDLWEEVDAYHFFTSMVQLKALVDGRAFILKKL
SSGIALTSAEDDLLKDLEAGIDKVESFIKSSSSGFINHEKGYIVETPSNLDQRSGLDIAV
IMASTLTHDSEDENDGYFTNYDQFSFLSAAPGPSSSSFTSADKTDTPFLFDIDDPLILNH
FNELVEKMAILYPINHNRLGTNMGVAVGRYPEDIYDGIGISEGNPWFISTLTSAELIFKL
VHKMHITQEPLIIEPLKNKFWHKIFAFGNLQNTSVMIPYNSLAFNQTLYTIFKYGDSFLS
KVNEHVSDQGHMSEQFNRYHGYNQGAENLTWSYGTFANALRWRQIVDNLIHPTNI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagcaactatgatgttaggttcgaaatatagaggtgaaaacaaggtaacgaaa
acgacacacttttttgtgtcatttgtctgcatttcctcatttttggtgtactattttttg
ttttcaccgcttcgagcagggtactacgagaaccaattctccgatggttcgggtcaatat
atacaagtaattgactttaacaaggtctccgactttcaacttcaaccgatcccattttca
aaaaatatttctagaaccgatttcaaccaatggttgaaagaccaggaacgagtttcgttt
gaacgtatgttcgataatatttgcaacgaagaatcgtcaggaaaattcgacaactgtttc
cccggtgtagttttcgcatctccatccaagagtaaaccggattacttttaccattggatt
agagatggcgccattaccattaacactttgatcaacacatattcggaggtcgacaaagaa
cgcactttgaaaacagtcttaaactacgtgaatgcttctatcgacttgcaacataggtct
aatccaagtggtcccgttgatgacccactattgagaaacttgggagaacctaaataccat
gttgacaattcgccatttgaacaggtttggggtagaccacaaaatgatggaccaccatta
agagccattgccttgttgaatttcttgaattcaatgaatgtgtccagcagtagcgatgcc
aacagtgattaccaatggatctttgatgatttaattacgttggacttaaagttcgtcttg
tacaactggcacgtctcaagcttcgatttgtgggaagaagtcgatgcgtaccatttcttc
acaagtatggttcaattgaaggctttggtcgatggtagagcattcatactgaaaaaactt
tcaagcggtattgcattaactagtgcggaagatgatctcttgaaagatcttgaggctggt
atcgataaggtggaatccttcatcaagagttccagttctggatttattaaccatgaaaag
ggctatattgtggagacaccaagtaacttggaccaaaggtctggtttagatatcgcagtc
attatggccagtaccttgacccatgattcagaagatgaaaacgatggatacttcaccaac
tatgaccaatttagcttcttgtccgcagcaccaggaccatcttcttcatcattcacctcg
gctgataaaactgatacgccatttttgtttgacatcgacgatccattaatcctaaaccac
ttcaacgagcttgttgagaaaatggctattctttacccaataaaccataatagactagga
actaacatgggtgttgctgttggaaggtatcccgaagatatttatgatggtattggcatt
tctgagggcaatccgtggtttatttctacattgacttctgcagagttgattttcaagttg
gtgcacaagatgcacattacgcaagagcccttaataatagaacctctaaagaacaagttt
tggcataaaattttcgcattcggtaacctacaaaatacctctgtaatgatcccatataat
tccttggcattcaaccagacattgtacaccattttcaagtacggggactcgttcttgagt
aaagtgaatgaacatgttagcgaccagggccacatgagcgagcaatttaacagatatcac
ggatacaaccaaggtgctgaaaacttgacttggtcatacggaacctttgccaatgcactc
cggtggagacaaattgtggataacttgattcacccaacaaacatctaa

DBGET integrated database retrieval system