KEGG   Kluyveromyces marxianus: KLMA_80302Help
Entry
KLMA_80302        CDS       T05269                                 

Gene name
TKL1
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00030  Pentose phosphate pathway
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
kmx01230  Biosynthesis of amino acids
Module
kmx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kmx_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KLMA_80302 (TKL1)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    KLMA_80302 (TKL1)
Enzymes [BR:kmx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     KLMA_80302 (TKL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 34718494
NCBI-ProteinID: XP_022678351
LinkDB All DBs
Position
8:complement(667466..669505)
Genome map
AA seq 679 aa AA seqDB search
MSQYSDIDRLAINTIRLLSVDQVASANSGHPGAPLGLAPAAHVVWKQMRLNPKNPEWINR
DRFVLSNGHACALLYSLLHLFGYDFSIEDLKQFRHLGSKTPGHPEFELPGVEVTTGPLGQ
GISNAVGLAIAQANFAATYNKPDFELSDSFTYVFLGDGCLQEGVSSEACSLAGHLKLKNL
IAFYDDNKITIDGNTNVSFDEDVGKRYEAYGWEVLSVENGNDDLDSISKALEQAKRSDKP
TLIKLVTTIGFGSLQAGTHAVHGAPLKADDIKQLKTKFGFNPEESFVVPQEVYDLYNKST
IEPGIEANNKWNALFEAYSAKFPELGAEIKRRLAGELPTGWENKLPTYTPKDSAVASRKL
SELLLQNIFEDIPELIGGSADLTPSNLTRTKEVVDFQAPSSGLGDYTGRYIRYGVREHGM
GAIMNGISAFGANYKPYGGTFLNFVSYAAGALRLSALSGHPVIWVATHDSIGLGEDGPTH
QPIETLAHFRALPNLQVWRPADGNEVSAAYKVALKSKHTPAVIALSRQNLPQLEGSSIEK
AAKGGYVLQDVEQPDIAIVSTGSEVGIAVEAAKVLAEKNIKARIVSLPDFHTFDQQPKEY
QLSVLPDGVPILSVEVLSTSGWAKYSHQQFGLNRFGASGKGPAVYEKFDFTPQGIASRAE
KTVEFYKGKQVYSPLNTAF
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatattccgatatcgatcgtctagctatcaacactatcagattgttgtctgtt
gaccaagttgcatcagccaactctggtcacccaggtgctccattgggtctagccccagca
gcccatgttgtgtggaagcaaatgagattgaacccaaagaacccagaatggatcaaccgt
gacagatttgttttgtctaacggtcacgcatgtgcattgttgtactccttgttgcatctg
tttggatacgacttctccattgaggatttgaagcaattcagacacttgggctccaagact
ccaggtcacccagaattcgaattgccaggtgtcgaagtgactactggtccattgggtcaa
ggtatctctaacgctgttggtttggctattgctcaggccaactttgctgccacttacaac
aagccagactttgaattgtctgactcattcacatacgtgtttttgggtgacggttgtttg
caagaaggtgtttcatctgaagcttgttctttggctggccatttgaaattgaagaacttg
attgccttttacgacgacaacaagatcaccatcgatggtaacaccaacgtgtctttcgac
gaagatgttggcaagagatacgaggcctacggctgggaagtgttgagcgtcgaaaacggt
aacgacgatctggactccatcagcaaggccttggagcaagccaagcgctccgacaagcca
actttgatcaaattggtcaccaccatcggtttcggttccctacaagccggtacccacgcc
gtccacggtgccccattgaaggccgacgatatcaagcaattgaagaccaagttcggcttc
aaccctgaagaatccttcgtcgtcccacaagaagtctacgacctatacaacaagtccacc
atcgaacctggtatcgaagccaacaacaagtggaacgctctattcgaggcctactccgcc
aagttcccagaattgggtgccgaaatcaagagaagacttgcaggtgaattgccaactggt
tgggaaaacaagttgccaacttacactccaaaggactccgccgtcgcttccagaaagttg
tccgagctcctattgcaaaacatcttcgaagacattccagaattgattggtggttccgcc
gatttgaccccatctaacttgactagaaccaaggaagttgtcgacttccaagctccctcc
tccggtctaggtgactacaccggtagatacatcagatacggtgtccgtgaacacggtatg
ggtgccatcatgaacggtatctccgctttcggtgctaactacaagccatacggtggtact
ttcttgaacttcgtctcttacgccgctggtgccttgagattgtccgctttgtccggtcac
ccagtcatctgggtcgccactcacgactccatcggtctaggtgaagatggtccaacccat
caacctatcgaaactttggcccacttcagagctcttccaaacttgcaagtttggagacca
gctgacggtaacgaagtttccgctgcttacaaggtcgccttgaagagcaagcacactcca
gccgtcattgctctatctagacaaaacttgcctcaattggaaggctcttccatcgaaaag
gccgccaagggtggttacgtcttgcaagacgtcgaacaaccagacatcgccatcgtctcc
actggttccgaagttggtattgccgtcgaagctgctaaggttttggctgaaaagaacatc
aaggcccgtatcgtctctctaccagacttccacacctttgaccaacaaccaaaggaatac
caattgtccgttctaccagatggtgtcccaatcttgtccgtcgaagtcttgtccacttcc
ggttgggctaagtactctcaccaacaattcggtttgaacagattcggtgcctccggtaag
ggtccagccgtctacgagaagttcgatttcactccacaaggtattgcttccagagctgaa
aagactgttgaattctacaagggtaagcaagtctattctcctttgaacactgctttctaa

DBGET integrated database retrieval system