KEGG   Kluyveromyces marxianus: KLMA_80408Help
Entry
KLMA_80408        CDS       T05269                                 

Gene name
SDH2
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00020  Citrate cycle (TCA cycle)
kmx00190  Oxidative phosphorylation
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
Module
kmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kmx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLMA_80408 (SDH2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KLMA_80408 (SDH2)
Enzymes [BR:kmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KLMA_80408 (SDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 34718595
NCBI-ProteinID: XP_022678452
LinkDB All DBs
Position
8:884645..885409
Genome map
AA seq 254 aa AA seqDB search
MFNVIFKRGLATEVKAAAPRLKTFKIYRWSPDTPAEKPRLQEYKVDLNQCGPMVLDALIK
IKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQNENKQTKIYPLPHMYIVRD
LVPDLTHFYKQYKSIQPYLQREKVPEDGKENLQSIADRKKLDGLYECILCACCSTSCPSY
WWNQEQYLGPAVLMQAYRWLIDSRDEASGIRKQMLQNSMSLYRCHTIMNCTRTCPKGLNP
GRAIAEIKKALAMD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgtcatatttaagagaggtttggccactgaggtcaaggctgctgctccaaga
ttaaagaccttcaagatttacagatggagtccagataccccagctgaaaagccacgtttg
caagaatacaaggtcgacttgaaccaatgtggtcctatggttttggatgctttgatcaag
attaagaacgaacaagatccaaccttgactttcagaagatcctgtagagaaggtatctgt
ggttcttgtgctatgaacattggtggtagaaacactttagcctgtttgtgcagaattgat
caaaatgaaaataagcaaactaagatttacccattgcctcacatgtacattgtgagagat
ttggtgcctgacttgactcacttctacaagcaatacaagtctatccaaccatatttacaa
agagaaaaggtcccagaagatggtaaggaaaacttgcaaagtattgcagaccgtaagaag
ttggatggtttgtacgaatgtatcttgtgtgcttgttgttccacatcttgtccatcttac
tggtggaaccaagaacaatacctaggtccagccgtgttgatgcaagcttaccgttggtta
atcgactctagagatgaggcctcgggtatcagaaagcaaatgcttcaaaactccatgtct
ttgtacagatgtcacacaattatgaactgtaccaggacttgtccaaagggtttgaaccca
ggtagagccattgctgaaattaagaaggctttggctatggactag

DBGET integrated database retrieval system