KEGG   Komagataeibacter nataicola: B0W47_01315Help
Entry
B0W47_01315       CDS       T04737                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kna  Komagataeibacter nataicola
Brite
KEGG Orthology (KO) [BR:kna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0W47_01315
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B0W47_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin DAO Thi4 FAD_binding_3 HI0933_like AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AQU86314
UniProt: A0A1U9RH97
LinkDB All DBs
Position
263683..265266
Genome map
AA seq 527 aa AA seqDB search
MLQDAIKTQLKGYLAGLAHPIVLEASLDDTPPSREMHELLHEVAALSDRVQVSEQGEATR
RPSFVIKQAGARTGNVSFAAIPMGHEFTSFVLAMLQVGGHAPKFSDDMVAQIRALPGDYN
FETYVALSCQNCPDVVQALNAMSVINSNIRNVTIDGALFQDEVSARNIMSVPQVYLNGVL
FETGRTDAGQILAKLDADAPKRAAAKLKDIAPFDVLIIGSGPAGASAAVYAARKGVRTGL
VAERFGGQMMDTEGIENFISVPETTGPRLSAALEAHVRAYDVDVIPGEVATELFPAVHPG
GLHGVALESGAILHARTVIVATGAHWRHLGVPGEEEYRNKGVAYCPHCDGPFYKGKRVAV
AGGGNSGVEAAIDLAGIVAHVTLLQRGSHLKADKVLCDKLATLPNVTVLTEALTTRIEGN
GRNVTGLTYRGGDGADHHVDLEGVFVQIGLLPNTDWLKDTVERNAFGEIVVNDHGATSVP
GVFAAGDATTTPYKQIVIAIGDGAKAALSAFDYLIRVPAPVEKKVPA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagatgccatcaagacgcagctcaagggttacctcgccggtctcgcgcacccc
atcgtgctcgaagcctcgctggatgataccccgccctcgcgtgagatgcatgaactgctg
cacgaggtcgccgccctttccgacagggtgcaggtgagcgagcagggcgaggccacgcgc
aggccttcctttgtcatcaagcaggccggggccaggacagggaacgtgagcttcgccgcc
atccccatgggccacgagttcacctccttcgtgctcgccatgctgcaggtgggtggccac
gcgcccaaattctctgatgacatggtggcccagatccgcgcccttccgggggattacaat
ttcgagacctatgtggcgctgtcatgccagaactgccccgacgtggtgcaggcgctcaac
gccatgagtgtcatcaactccaatattcgcaacgtcacgatcgatggcgcattgtttcag
gatgaagtgagcgcgcgcaacatcatgtcggtgccgcaggtctacctcaatggcgtgctg
ttcgagaccggtcgcaccgatgcgggccagatcctggcaaagctcgatgcggatgcgcca
aaacgcgccgcggcaaagctgaaggatatcgcaccctttgacgtgctgattatcggcagc
gggcctgccggggcctcggctgcggtctatgcggcgcgcaagggggttcgcaccggtctg
gtggccgagcgttttggcggccagatgatggataccgaaggcatcgagaacttcatctcc
gtgcccgagacaaccggcccgaggctttcggcagcactggaagcccatgtgcgcgcctat
gatgtcgatgtcataccgggcgaggtggcaaccgaactcttccccgccgtccatcccggc
gggctgcatggcgtggcgctggaaagtggcgcgatcctgcacgcccgcaccgtcatcgtg
gccaccggcgcgcactggcgccaccttggcgtgccgggcgaggaggaataccgcaacaag
ggcgtggcctactgcccgcattgcgatggcccgttctacaagggcaagcgcgtggcggtg
gcaggtggcggcaatagcggggtggaggcggcgatcgaccttgccggcatcgtggcgcat
gtcacgctgctccagcgcggctcccacctcaaggcggacaaggtgctgtgcgacaagctg
gccaccctgcccaacgtgaccgtgctgaccgaggcgctgaccacgcgcatcgagggtaac
ggccgcaacgtgaccgggctgacctatcgcggcggtgacggggcggaccatcatgtcgat
ctggaaggcgtgttcgtgcagatcggcctgctgcccaatacggactggctgaaggacacg
gtggagcgcaacgcgtttggcgagatcgtggtcaatgatcatggcgcgacctcggtgccc
ggcgtgtttgccgcaggtgatgccaccaccacgccctacaagcagattgtcatcgccata
ggtgatggcgcgaaggcggcgctctcggcgtttgactatctcatccgcgtgccagccccg
gtggagaagaaggtgcctgcctga

DBGET integrated database retrieval system