KEGG   Komagataeibacter nataicola: B0W47_03405Help
Entry
B0W47_03405       CDS       T04737                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kna01100  Metabolic pathways
kna01110  Biosynthesis of secondary metabolites
kna01130  Biosynthesis of antibiotics
kna01230  Biosynthesis of amino acids
kna02024  Quorum sensing
Module
kna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B0W47_03405
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    B0W47_03405
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B0W47_03405
Enzymes [BR:kna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     B0W47_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AQU88858
UniProt: A0A1U9RPJ9
LinkDB All DBs
Position
complement(692588..693184)
Genome map
AA seq 198 aa AA seqDB search
MILLIDNYDSFTFNLVHYLGDLGETCDVYRNDAISVEEALALGPEAIVISPGPCSPNEAG
ICCDLIAAAAGRVPVFGVCLGHQAIGQVFGGRVVRAPMPMHGKVSPVYHDGTGVFAGLPD
PFNATRYHSLTVDPDSLPDTLVPTAHTSDGVIMGLRHASLPIFGVQFHPESIASEYGHEI
MANFLSIARGRNTPRKAA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcctgatcgacaattatgacagtttcacgttcaatctcgtccattacctcggt
gatctgggcgagacatgcgatgtgtaccgtaacgatgccatcagcgtggaagaagcgctt
gcgctcgggcccgaggccattgtcatctcgcccggcccctgttcgcccaacgaggccggg
atctgctgcgacctgatcgccgccgccgcaggcagggtgccggtctttggggtctgcctt
ggccaccaggccatcggccaggtgtttggtggcagggtggtgcgcgcgcccatgcccatg
catggcaaggtctcgccggtctatcatgatggcaccggcgtctttgccggcctgcccgat
cccttcaacgccacccgctaccacagcctgacggtcgatcccgacagcctgcccgatacg
ctggtacccaccgcccatacatccgatggcgtgatcatgggcctgcgccacgccagcctg
ccgatctttggcgtgcagttccaccccgagagcatcgcctcggaatatggccacgagatc
atggccaatttcctgtccatcgcgcgtggcaggaacacaccgcgcaaggccgcctga

DBGET integrated database retrieval system