KEGG   Komagataeibacter nataicola: B0W47_06520Help
Entry
B0W47_06520       CDS       T04737                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
kna  Komagataeibacter nataicola
Brite
KEGG Orthology (KO) [BR:kna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0W47_06520
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     B0W47_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AQU87188
UniProt: A0A1U9RJU0
LinkDB All DBs
Position
1349473..1350591
Genome map
AA seq 372 aa AA seqDB search
MARHTRAAVALLQAGSILNVYTEASHINIGSCLTEALVIHAPHDLRLDPAPLPQPGPDEV
RVNMAWGGICGSDLHYFAHGGVGASVLHAPMVLGHEVSGTIDALGCDVKGFSAGEAVAIH
PAQPCGHCPECAREQRNLCRNMRFLGSAARNPHTDGGFRRAMTLKATQLHSLPPGLTLRR
ACLAEPLSVALHAIARAGDVRGRSVMVQGAGPIGLLIVAGLVHHGAKRIVVTDLEDFPLQ
CATRLGASRCYNTRHTVVEEEFDILFEATGVPAALPAAITRTRRGGILVQVGMFPPGDID
VPIAQIISRELDFRGTFRFDTEFDAALALLAERPEIADILVTQQFPLSDFAAAFALAPDR
RQAAKILLSLNS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccatacccgtgcagcggtggccctgttacaggcagggagcatcctgaacgtg
tacactgaagcaagtcatataaacatcggttcctgcctgaccgaagcactggttatccat
gcgccgcatgacctgaggctggaccccgcccccctgcctcaacccggccccgatgaagtg
cgggtgaatatggcctggggcggcatatgcggttcggacctgcattattttgcccatggg
ggtgtcggggcatccgtgctgcatgcccccatggttcttgggcatgaagtctcgggcacc
attgatgcgctgggctgcgatgtaaaaggtttttccgcaggcgaggccgtggccattcat
ccggctcagccctgtggtcactgccccgaatgcgcgcgcgaacagcgcaacctgtgtcgc
aatatgcgttttctgggaagtgccgcacgtaatccccataccgatggcggcttccgtcgg
gcgatgacgctcaaggcgacacagctccattcccttcctcccggcctgacgctccgccgg
gcctgccttgccgaaccgttatccgtggccctgcatgccattgcgcgcgcgggcgatgtg
cgcggtcgtagcgtgatggtgcagggggccggaccaatcgggctgttaatcgtggcggga
ctggtacatcacggagcaaaacggattgtggtaaccgacctggaggattttccactccag
tgcgcaacccggctgggtgcaagccggtgctacaacacccgccataccgtggtggaggaa
gaattcgatatcctgtttgaagccacaggcgtgccagccgccctgcctgccgccataacc
cgcacacgccgcggcggcatactggtgcaggttggcatgttcccgccgggagacatagat
gtgccgattgcccagatcatcagccgtgaacttgatttcaggggcacgttccggttcgat
acggaattcgatgcagcccttgccttactggctgaacggcctgaaattgccgatattctg
gtcacccaacagtttcccctgagcgactttgccgcagcctttgcgctggcgccagaccgc
aggcaggcagccaagatcctgctatccctgaacagttga

DBGET integrated database retrieval system