KEGG   Komagataeibacter nataicola: B0W47_09955Help
Entry
B0W47_09955       CDS       T04737                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00020  Citrate cycle (TCA cycle)
kna00310  Lysine degradation
kna00380  Tryptophan metabolism
kna01100  Metabolic pathways
kna01110  Biosynthesis of secondary metabolites
kna01120  Microbial metabolism in diverse environments
kna01130  Biosynthesis of antibiotics
kna01200  Carbon metabolism
Module
kna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B0W47_09955
  09105 Amino acid metabolism
   00310 Lysine degradation
    B0W47_09955
   00380 Tryptophan metabolism
    B0W47_09955
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     B0W47_09955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AQU87744
UniProt: A0A1U9RLD2
LinkDB All DBs
Position
2053354..2056227
Genome map
AA seq 957 aa AA seqDB search
MAGVDILSTAFSGANTAYLAELYARWVADPNSVDPSFASLFQELHEEGTEIVHDAEGASW
APRPHIITGDEPAPLPGGKAAGVTAESLKAAADDSLRATQLIRAFRVRGHLEARLDPLGL
QVPKPHADLDPATYGFGPKDCDRPIYLGHIVASLIGSDTATINQVLDALRAVYCGPIGAE
FMHIQDPEQRMWVQARLEGDNWRKGASPEQKKVILQQLTEAEGFESFCQKRYVGTKRFGL
EGEDVTIPALHAIIDQAAAGGVRSVAIGMPHRGRLNTLVNIVRKPYTAIFSEFAGVSFKP
DDVQGSGDVKYHLGTSTDVEIGGTPVHISLQPNPSHLEAVDPVVIGKVRATQDDDDPHQR
GRHMGVLLHGDAAFAGQGIVYETLAMSQLIGYRTGGTIHVVVNNQIGFTTVSVHSFSGLY
CTDVAKAVQAPILHVNGDEPEAVIYCSRLAAEFRQKFASDVVLDIVGYRRHGHNESDEPS
FTQPTMYKAIAARPTIRTLYSDRLVREGVVTEAEVTAEWDGFHNKLEQAYQAAQGYKPNK
ADWLEGAWKGLKPPPVDTTLPAPETGVSIDRLKEVGASLAHVPDDFNANPKIIRQLKAKA
KMFETGAGIDWATGEALGFGTLLLDKHHVRLSGEDCQRGTFSQRHAVLIDQVNQNTYVPL
NNIAKDQAAIEIYNSLLSEFGVLGFEYGYSLADPNALVLWEAQFGDFANGAQVIIDQFIA
SGETKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCAENNMRVCNITTPANYFHALR
RQLFLDYRKPLIIMTPKSLLRHKLAVSELKDFGPGTRFLPVIGEIDPIAAPDKVDRVVIC
SGKVYYDLLAERRERKLDNVAILRLEQFYPFPGKMLGEELARYRQAKVIWCQEEPENMGG
WTFVDRLIEGVLTDIGHKSTRPTFVGRVAAASPATGLAKVHVAEQAALVNKALGVSA
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtagatattctttcgaccgcattcagcggcgccaatacggcctatctggcc
gagttgtatgcgcgctgggtggccgatcccaacagcgtcgatccttcctttgcctccctg
tttcaggaactgcatgaggaaggcaccgaaatcgttcatgatgcggaaggggcctcctgg
gcgccgcgcccgcatatcatcactggcgatgaaccggcccccctgccgggtggcaaggcg
gcgggcgttacggcggagagcctgaaggcggcggctgatgacagcctgcgcgcgacccag
ctcatccgcgccttccgcgtgcgtggccaccttgaggcgcggctcgatccgctcggcctg
caggtgcccaagccccatgcggatctcgaccccgccacctacggcttcggccccaaggac
tgcgaccgcccgatctatcttggccacatcgtcgccagcctgatcggctcggacaccgcc
accatcaatcaggtgctcgatgccctgcgcgcggtctattgcgggccgatcggcgccgag
ttcatgcacatccaggaccccgagcagcgcatgtgggtgcaggcgcgccttgagggtgac
aactggcgcaagggcgcaagcccggagcagaaaaaggttatcctgcagcagctgaccgag
gcggagggtttcgagtccttctgccagaagcgctatgtcggcaccaagcgcttcggcctt
gagggcgaggacgtgaccatccccgcgctgcacgccatcatcgaccaggcggccgcaggc
ggcgtgcgctcggtggccatcggcatgccgcatcgcgggcgtctgaacacgctcgtcaac
atcgtgcgcaagccctatacggccatcttcagtgaattcgccggcgtgtccttcaagccg
gacgacgtgcagggctcgggcgatgtgaaataccatctcggcacctccaccgatgtcgag
attggcggtacgcccgtgcatatctcgctccagcccaacccctcgcatcttgaggcggtg
gacccggtcgtgatcggcaaggtgcgcgcgacgcaggatgatgacgacccccaccagcgc
ggccgccacatgggcgtgctgctgcatggtgacgccgcattcgcggggcagggcatcgtg
tatgaaacgctggccatgtcgcagctcatcggctaccgcacaggcggcacgatccacgtc
gtggtcaataaccagatcgggttcaccaccgtatcggtccattccttctcgggcctgtac
tgcacggacgtggccaaggcggtgcaggccccgatcctgcacgtcaatggcgacgagccg
gaggcggtgatctactgttcgcgccttgccgccgagttccgccagaagttcgcgtccgac
gtggtgctcgacatcgtgggctaccgccgccacggccataacgagtccgatgagccgtcc
ttcacccagcccaccatgtacaaggccatcgcggcgcggcctaccatccgcacgctgtat
tccgatcgcctcgtgcgcgaaggcgtggtgaccgaagctgaagtgaccgccgagtgggat
ggtttccacaacaagctcgagcaggcctatcaggccgcccagggctacaagcccaacaag
gccgactggctggaaggcgcgtggaaaggcctcaagccgccgccagtcgacacgaccctg
cccgcgcccgaaaccggtgtttccatcgaccggctgaaggaagtcggcgcatcgctggct
catgtgcccgatgacttcaacgccaaccccaagatcatccgccagctcaaggccaaggcg
aagatgttcgagaccggcgcgggcatcgactgggccacgggcgaggcgctgggcttcggc
acgctgctgcttgacaagcaccatgtccgcctgtcgggcgaggactgccagcgcggcacc
ttcagccagcgccatgcggtgctgatcgatcaggtgaaccagaacacctacgtgccgctc
aacaacatcgccaaggaccaggcggccatcgagatctacaactcgctgctgtccgaattc
ggcgtgctgggctttgaatacggctactcgctggccgaccccaatgcgctggtgctgtgg
gaggcgcagttcggtgacttcgccaacggcgcgcaggtcatcatcgaccagttcatcgcc
tcgggcgagaccaagtggctgcgcatgtcgggcctcgtgatgctgctgccgcatggctat
gaggggcaggggccggagcattcctccgcccgcctcgagcgctacctgcagctttgcgcc
gagaataacatgcgggtgtgcaacatcaccacgcccgccaactacttccacgcgctgcgc
cgccagttgttcctcgactaccgcaagccgctgatcatcatgacgccgaagtccctgctg
cgccataagctggcggtgtcggaactcaaggatttcgggccgggcacgcgcttcctgccg
gtcattggcgagatcgacccgatcgcagcgcctgacaaggtggaccgggtggtgatctgc
tcgggcaaggtctattacgacctgctggccgaacgccgtgagcgcaagctcgataacgtc
gcaatcctgcgcctcgagcagttctatcccttccccggcaagatgctgggcgaggaactg
gcccgctacaggcaggccaaggtgatctggtgccaggaagaacccgagaacatgggcggc
tggacctttgtcgatcgcctgatcgagggcgtgctgaccgatattggccacaagagcacg
cgcccgacctttgtggggcgggttgcggcggccagcccggccacgggccttgccaaggtg
catgttgccgagcaggcggcgctggtgaacaaggcgctgggcgtcagcgcctga

DBGET integrated database retrieval system