KEGG   Komagataeibacter nataicola: B0W47_11000Help
Entry
B0W47_11000       CDS       T04737                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B0W47_11000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kna02000]
    B0W47_11000
Enzymes [BR:kna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B0W47_11000
Transporters [BR:kna02000]
 Other Transporters
  Pores ion channels [TC:1]
   B0W47_11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AQU87909
UniProt: A0A1U9RMB6
LinkDB All DBs
Position
2265348..2266040
Genome map
AA seq 230 aa AA seqDB search
MITVHHLDNSRSQRILWLLEELELPYEIRFYKRDPKTMLAPKSLRKVHPLGKAPIITDTE
SDVTLAESGAIIEYLVERYGNGRLQPERGTPEHVQFLYWLHYAEGSAMPPLLLKLVFGLL
PTRVPFIIRPVASLIAGGVQSRIINPQLKLHMDFWEHALSQREWFTGKDFTAADIQMSFP
LEAAASRAGALGGRPHVGAFLRRIHARPAYQRALIKGGAYAFASAGDAAG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgtgcatcatctcgacaattcgcgttcccagcgcatcctgtggctgcttgag
gaacttgagctgccctacgagatccgtttctacaaacgcgaccccaaaaccatgctggcc
ccaaaaagcctgcgcaaggtccacccgctgggcaaggccccgatcattacggataccgag
agcgacgtgacgcttgcggaaagcggggccattatcgaataccttgtcgaacgctacggc
aacgggcggctgcagcccgaacgcggcacgcccgagcacgtgcagtttctgtactggctg
cactatgccgaaggctcggccatgccgccgctgctgctcaagctggtattcggcctgctg
cccacgcgcgtgccctttatcatccgccccgtggccagcctgatcgcgggcggggtgcag
tcacgcatcatcaacccgcagcttaaactgcacatggatttctgggagcacgcactcagc
cagcgtgaatggttcacgggcaaggacttcaccgcggccgatatccagatgagctttccg
cttgaagccgcagcctcccgcgccggagcgctgggcggcaggccgcatgtgggtgccttt
ttgcggcgcatccatgcacggcctgcctatcagcgcgcgctgatcaaagggggcgcctat
gcctttgcctcggcgggtgatgcggctggctga

DBGET integrated database retrieval system