KEGG   Komagataeibacter nataicola: B0W47_13760Help
Entry
B0W47_13760       CDS       T04737                                 

Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
kna  Komagataeibacter nataicola
Pathway
kna02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B0W47_13760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kna02000]
    B0W47_13760
Transporters [BR:kna02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    B0W47_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_16 AAA_25 SMC_N AAA_21 RsgA_GTPase DUF87 AAA_24 AAA_22 AAA_33 AAA_29 T2SSE IstB_IS21 AAA_18
Motif
Other DBs
NCBI-ProteinID: AQU88355
UniProt: A0A1U9RPH0
LinkDB All DBs
Position
2867181..2868878
Genome map
AA seq 565 aa AA seqDB search
MKSSQTGELNRMARREGVLAPVGRILQIWQRRAPLLTAGALLSLLALIIGLVLMREAGIR
VAAMTMGMIVVTTGALRIFGSARVILRYAERLVAHDAMFRALADVRVWFFRHLARGAAAG
LGFRRAGDLLSRLVSDVETLDGLYLRIILPLAGACLVLPFLFIAINMVSTVLAVVVCALF
ACGAFGLPLCAAMLGRREGGLVNHEAAQLRVGVLDMVGGLREITTFGAEGRMLDHVRDRD
AALCRAQMKQARMLALAGAASYLCGQAAVVAVLAAAMGLGLPHIAPLPAAAVLFLTVAAF
ESIGGLTRAGALAGNITRAAARVVAVGDLPEHAPPEGTQPAPQGTDIRFEQVSFRWDESR
APVLDHLDLNIPAGQRIAVMGPSGAGKSTLAALLLKVVGPQAGRITLGGEDIATIRDEAM
RERIAWLSQATHLFTDTIRANLLLGRPDATEADLWAALEQARVADVVRALPDGLDSWLGE
GGASVSGGQGRRLALARVLLSRAPILILDEPATGLDARTEREFLLTLNEVTQGRTVILIV
HRLTGVEKLDQAWRIVGGKTVAATA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcctcacagacaggggaactcaaccgcatggcccggcgcgagggcgtgctcgcc
cccgtaggccgcatcctgcagatctggcagcgtcgcgcgccgctgctgacggcgggtgcg
ctgctgtcgctgctggcgctcatcatcggccttgtgctgatgcgcgaggcaggcatccgc
gtcgcggccatgaccatgggcatgatcgtggtcaccaccggggcgctgcgcatttttggc
agtgcgcgggtgatcctgcgctacgcggagcggctggtcgcgcatgatgccatgttccgc
gcgctggcggatgtgcgggtatggttcttccgccaccttgcgcgcggggctgcggcgggg
cttggcttccgccgcgcgggcgacctgctctcgcgccttgtgtcggatgtcgagacgctg
gacgggctttacctgcgcatcatcctgccgctggcgggcgcgtgcctggtgctgccgttc
ctgttcatcgccatcaacatggtcagtacggtgctggccgtggtggtgtgcgcgctgttc
gcctgcggggcgttcgggctgccgctctgtgccgccatgctggggcggcgcgaaggcggg
ctggtcaaccatgaggcggcgcaactgcgcgtgggcgtgctcgacatggtgggtggcctg
cgcgaaatcacgaccttcggggcggaggggcgcatgctcgaccatgtgcgcgaccgtgat
gcagcactctgccgcgcgcagatgaagcaggcccgcatgctggccctggctggggccgcc
tcctatctgtgcgggcaggcagcagttgtggcggtgctggcagcggccatggggctgggc
ctgccgcacattgctccgctgcctgccgccgccgtgctattcctgacggttgcggccttc
gagagcattggcgggctgacgcgcgcgggtgcgctggctggcaacatcacccgcgccgcc
gcccgcgtggtggcggtgggcgatctgcccgagcatgcgccgcccgaaggcacgcagcct
gcgcctcagggcaccgatatccgtttcgagcaggtctccttccgttgggatgagtcccgc
gcgcccgtgcttgatcaccttgacctgaatattcccgcaggccagcgcattgcggtcatg
gggccttcgggggcgggcaagtccacgctggcagcccttctgctcaaggtggtggggccg
caggcggggcgcattacgctggggggcgaggatatcgccaccattcgcgatgaagcgatg
cgtgagcggattgcatggctgtcacaggcgacgcatctgtttacggacacgattcgcgcc
aacctcctgcttggccgccccgacgccaccgaggctgacctgtgggcggcactggagcag
gcccgcgtggccgatgtggtccgcgccctgccagatgggctggatagctggctgggtgaa
ggcggggcgagtgtgtcgggcgggcaggggcggcggctggcgctggcccgcgtgctgctg
tcgcgcgcgccgatcctgatccttgatgaaccggcgaccgggctggatgcccggaccgag
cgtgaattcctccttaccctcaatgaagtgacgcaggggcgcacggtcattctgatcgtg
caccggctgacgggtgtggaaaagctggatcaggcatggcgtatcgtgggtggtaaaacc
gtggcggctacggcatga

DBGET integrated database retrieval system