KEGG   Klebsiella oxytoca CAV1374: AB185_06445Help
Entry
AB185_06445       CDS       T04534                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00620  Pyruvate metabolism
koc00680  Methane metabolism
koc01100  Metabolic pathways
koc01120  Microbial metabolism in diverse environments
koc01200  Carbon metabolism
Module
koc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:koc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB185_06445
  Energy metabolism
   00680 Methane metabolism
    AB185_06445
Enzymes [BR:koc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AB185_06445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKL33555
UniProt: A0A0G3S169
LinkDB All DBs
Position
245047..247698
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKEQPNLNET
IIKQAVESLSLELVLTAHPTEITRRTLIHKMGEINSCLKQLDNNDIADYERHQVMRRLRQ
LIAQSWHTDEIRKHRPTPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEDNLNYRLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQLLISELSMVECTDELR
ELAGAEGAQEPYRYLMKKLRTQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
QSLQACGMSIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLETCKVISEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAQWRDIMAEL
SDVSCEMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELESMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWKLGEELRELLSADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEKGEKPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgtagtaatgtcagtatgctcggtaaggtgctgggc
gacaccatcaaggatgcgctgggagaaaacattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttctcgcgctggcaatgaagccaaccgccaggagctgctcaccacgctg
caaaacttgtccaacgacgagctgctgccggtggcgcgcgcctttagccagtttctgaac
ctggcgaataccgctgagcaataccacagcatttcgccaaaaggcgaagcggccagtaat
ccggaagtgattgcccgcaccctgagaaagctcaaagagcaacccaatctcaacgaaacg
attattaaacaagccgttgaatccctgtcgctggagctggtgctgaccgcgcacccgacc
gaaatcacgcgtcgtacgctgatccacaagatgggcgagatcaacagctgcctgaagcag
ctcgataacaacgacattgcggactatgaacgtcatcaggtcatgcgccgtctgcgccag
ctgattgcccagtcgtggcacaccgatgaaatccgcaagcatcgccctaccccggtggat
gaagccaaatggggcttcgcggttgtcgaaaatagcctgtgggaaggcgtaccgaactac
ctgcgcgagctgaatgaacagctggaagataacctgaactatcggctgccggtcgatttt
gttccggttcgctttacgtcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
gccgacattacccgccacgtcctgctgctcagccgctggaaggcaaccgatctgttcctg
aaagatgtccagctgttgatttcagagctgtcgatggttgagtgcaccgacgagctgcgt
gagctggcaggcgcggaaggcgctcaggaaccctatcgttacctgatgaaaaaactgcgc
acgcagctgatggagacccaggcctggctggaagcgcgcctgaaaggacagaaactgccg
aaaccggcgggccttatcacgcaaaacgagcagctgtgggaaccgctttacgcctgttac
cagtcgctacaagcctgcggtatgagcattatcgccaacggcgagctgctcgataccctg
cgccgcgtaaaagcctttggcgtaccgctggtgcgtatcgatatccgtcaggaaagcacc
cgccacaccgaagcgctgggcgaaatgacccgctatctcggcatcggcgactatgaaagc
tggtcagaagccgataaacaggccttcctgatccgcgaactgaactccaagcgtcctctg
ctgccgcgccagtgggagccaagcgaagaaacgcgcgaagtgctcgagacgtgcaaagtc
atctccgaagcgccgcgcggctctattgcggcctacgtgatttcgatggcgaaaacgccg
tcagacgtcctggccgtgcatctgctgttgaaagaggccggcatcggcttcgcgctgccg
gtcgccccgctgttcgaaacgctggacgacctgaataacgccgacgacgttatgacccaa
ctgctgaatatcgactggtatcgcggctttatccagggcaagcagatggtcatgatcggc
tattccgactcggcgaaagatgcgggcgtgatggccgcctcctgggcgcagtatcaggcg
caggacgcgttaattaagacctgtgaaaaagccggcattgaactgacgctgttccacggt
cgcggcggttctatcggccgcggcggcgcgccggcgcacgcggccctgctctctcagcct
ccgggaagcctgaaaggcggtctgcgcgttaccgaacagggcgagatgatccgctttaaa
tacggcctgccggaagtcaccatcagcagcctgtcgctctacaccagcgcgattctggaa
gccaacctgctgccgccgccggagccaaaagcgcaatggcgcgacatcatggccgagctg
tccgacgtctcctgcgagatgtatcgcggctacgtgcgtgaaaataaagattttgttcct
tacttccgttccgcgacgccggagcaggagctgggcaaactgccgctgggctcgcgtccg
gcaaaacgtcgcccgaccggcggcgtcgagtcgctgcgcgctattccgtggatcttcgcg
tggacgcaaaaccgcctgatgctgccagcctggctgggcgccggcgccgcgctgcaaaaa
gtcgttgaaggcggcaagcagagcgagctggaaagcatgtgccgcgactggccgttcttc
tctacccgcctcggcatgctggagatggtctactcaaaagccgacctgtggctggcggaa
tattacgatcagcgtctggtgaaaccggaactgtggaagctgggcgaagagctgcgtgaa
ctgctgtccgccgatatcaacgtggtactggcaatcgccaacgactcccacctgatggcc
gacctgccgtggatcgcggagtccatccagctacgtaatatctataccgacccgctgaac
gtgctccaggccgagctgctccatcgttcacgtctggcggaagagaaaggtgaaaaaccg
gacccgcgcgttgagcaagcgctgatggtcaccatcgcaggcgttgcggcaggcatgcgt
aacaccggctag

DBGET integrated database retrieval system